Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7316
Gene name Gene Name - the full gene name approved by the HGNC.	Ubiquitin C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UBC
Synonyms (NCBI Gene) Gene synonyms aliases	HMG20
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene represents a ubiquitin gene, ubiquitin C. The encoded protein is a polyubiquitin precursor. Conjugation of ubiquitin monomers or polymers can lead to various effects within a cell, depending on the residues to which ubiquitin is conjugated. Ubiq

Show/Hide all(84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030628	hsa-miR-24-3p	qRT-PCR	19748357
MIRT050710	hsa-miR-18a-5p	CLASH	23622248
MIRT046896	hsa-miR-221-3p	CLASH	23622248
MIRT042909	hsa-miR-324-3p	CLASH	23622248
MIRT042909	hsa-miR-324-3p	CLASH	23622248
MIRT039711	hsa-miR-615-3p	CLASH	23622248
MIRT039711	hsa-miR-615-3p	CLASH	23622248
MIRT039075	hsa-miR-769-3p	CLASH	23622248
MIRT038409	hsa-miR-296-3p	CLASH	23622248
MIRT037302	hsa-miR-877-5p	CLASH	23622248
MIRT439367	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439366	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439367	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726202	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726200	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726201	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726199	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439366	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT1466908	hsa-miR-106a	CLIP-seq
MIRT1466909	hsa-miR-106b	CLIP-seq
MIRT1466910	hsa-miR-130a	CLIP-seq
MIRT1466911	hsa-miR-130b	CLIP-seq
MIRT1466912	hsa-miR-17	CLIP-seq
MIRT1466913	hsa-miR-20a	CLIP-seq
MIRT1466914	hsa-miR-20b	CLIP-seq
MIRT1466915	hsa-miR-301a	CLIP-seq
MIRT1466916	hsa-miR-301b	CLIP-seq
MIRT1466917	hsa-miR-454	CLIP-seq
MIRT1466918	hsa-miR-488	CLIP-seq
MIRT1466919	hsa-miR-519a	CLIP-seq
MIRT1466920	hsa-miR-519d	CLIP-seq
MIRT1466921	hsa-miR-653	CLIP-seq
MIRT1466922	hsa-miR-93	CLIP-seq
MIRT1466908	hsa-miR-106a	CLIP-seq
MIRT1466909	hsa-miR-106b	CLIP-seq
MIRT1466910	hsa-miR-130a	CLIP-seq
MIRT1466911	hsa-miR-130b	CLIP-seq
MIRT1466912	hsa-miR-17	CLIP-seq
MIRT1466913	hsa-miR-20a	CLIP-seq
MIRT1466914	hsa-miR-20b	CLIP-seq
MIRT1466915	hsa-miR-301a	CLIP-seq
MIRT1466916	hsa-miR-301b	CLIP-seq
MIRT1466917	hsa-miR-454	CLIP-seq
MIRT1466918	hsa-miR-488	CLIP-seq
MIRT1466919	hsa-miR-519a	CLIP-seq
MIRT1466920	hsa-miR-519d	CLIP-seq
MIRT1466921	hsa-miR-653	CLIP-seq
MIRT1466922	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SP1	Unknown	19733223
SP3	Unknown	19733223

Show/Hide all(66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000715	Process	Nucleotide-excision repair, DNA damage recognition	TAS
GO:0000717	Process	Nucleotide-excision repair, DNA duplex unwinding	TAS
GO:0002020	Function	Protease binding	IPI	21185309
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0002756	Process	MyD88-independent toll-like receptor signaling pathway	TAS
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	8702753, 16256071, 16424905, 16482222, 16763556, 16810318, 16845370, 16874300, 16874301, 16936636, 16996503, 17006543, 17028573, 17067581, 17070805, 17110928, 17139261, 17159902, 17170702, 17183367, 17255943, 17268548, 17290220, 17304240, 17318174, 17318178, 17320083, 17363902, 1736
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006294	Process	Nucleotide-excision repair, preincision complex assembly	TAS
GO:0006296	Process	Nucleotide-excision repair, DNA incision, 5'-to lesion	TAS
GO:0006297	Process	Nucleotide-excision repair, DNA gap filling	TAS
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007254	Process	JNK cascade	TAS
GO:0010008	Component	Endosome membrane	TAS
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0016197	Process	Endosomal transport	TAS
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016567	Process	Protein ubiquitination	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019058	Process	Viral life cycle	TAS
GO:0019068	Process	Virion assembly	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019941	Process	Modification-dependent protein catabolic process	IBA	21873635
GO:0019985	Process	Translesion synthesis	TAS
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031386	Function	Protein tag	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031982	Component	Vesicle	HDA	19190083
GO:0033683	Process	Nucleotide-excision repair, DNA incision	TAS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0036297	Process	Interstrand cross-link repair	TAS
GO:0042276	Process	Error-prone translesion synthesis	TAS
GO:0042769	Process	DNA damage response, detection of DNA damage	TAS
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043657	Component	Host cell	IEA
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS
GO:0051403	Process	Stress-activated MAPK cascade	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0061024	Process	Membrane organization	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070911	Process	Global genome nucleotide-excision repair	TAS
GO:0070987	Process	Error-free translesion synthesis	TAS
GO:0075733	Process	Intracellular transport of virus	TAS

MIM	HGNC	e!Ensembl
191340	12468	ENSG00000150991

Protein

UniProt ID

P0CG48

Protein name

Polyubiquitin-C [Cleaved into: Ubiquitin]

Protein function

[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys re

PDB

1C3T , 1CMX , 1D3Z , 1F9J , 1FXT , 1G6J , 1GJZ , 1NBF , 1OGW , 1Q5W , 1S1Q , 1SIF , 1TBE , 1UBI , 1UBQ , 1UD7 , 1XD3 , 1XQQ , 1YX5 , 1YX6 , 1ZGU , 2AYO , 2BGF , 2DEN , 2FUH , 2G45 , 2GBJ , 2GBK , 2GBM , 2GBN , 2GBR , 2GMI , 2HTH , 2IBI , 2J7Q , 2JF5 , 2JRI , 2JY6 , 2JZZ , 2K25 , 2K6D , 2K8B , 2K8C , 2KDF , 2KHW , 2KJH , 2KLG , 2KN5 , 2KX0 , 2L3Z , 2LD9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 74	Ubiquitin family	Domain
PF00240	ubiquitin	79 → 150	Ubiquitin family	Domain
PF00240	ubiquitin	155 → 226	Ubiquitin family	Domain
PF00240	ubiquitin	231 → 302	Ubiquitin family	Domain
PF00240	ubiquitin	307 → 378	Ubiquitin family	Domain
PF00240	ubiquitin	383 → 454	Ubiquitin family	Domain
PF00240	ubiquitin	459 → 530	Ubiquitin family	Domain
PF00240	ubiquitin	535 → 606	Ubiquitin family	Domain
PF00240	ubiquitin	611 → 682	Ubiquitin family	Domain

Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGV

Sequence length

685

Interactions

View interactions

UBC (ubiquitin C)