Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7189
Gene name Gene Name - the full gene name approved by the HGNC.	TNF receptor associated factor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRAF6
Synonyms (NCBI Gene) Gene synonyms aliases	MGC:3310, RNF85
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from, members of the TNF receptor superfamily. This protein mediates signaling fro

Show/Hide all(589)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000711	hsa-miR-146a-5p	Western blot, Northern blot	18504431
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Western blot	20061417
MIRT000711	hsa-miR-146a-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	20375304
MIRT000711	hsa-miR-146a-5p	qRT-PCR	18759964
MIRT000711	hsa-miR-146a-5p	Immunoprecipitaion, Western blot, Communoprecipitaion	19898489
MIRT000711	hsa-miR-146a-5p	qRT-PCR, Western blot, Immunofluorescence	19918258
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT005394	hsa-miR-146b-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT005394	hsa-miR-146b-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT000711	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	20542134
MIRT000711	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	20542134
MIRT000711	hsa-miR-146a-5p	qRT-PCR, Western blot	21178010
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21610143
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay	22593544
MIRT000711	hsa-miR-146a-5p	Western blot	20110513
MIRT000711	hsa-miR-146a-5p	ELISA, Northern blot, Western blot	23685241
MIRT000711	hsa-miR-146a-5p	Microarray	25205119
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay	24107356
MIRT438046	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24360988
MIRT438046	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24360988
MIRT000711	hsa-miR-146a-5p	Microarray	25205119
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay	24107356
MIRT438046	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24360988
MIRT438046	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24360988
MIRT565241	hsa-miR-3940-3p	PAR-CLIP	20371350
MIRT565240	hsa-miR-1247-3p	PAR-CLIP	20371350
MIRT565239	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT565238	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT565237	hsa-miR-6134	PAR-CLIP	20371350
MIRT565236	hsa-miR-377-5p	PAR-CLIP	20371350
MIRT565235	hsa-miR-6086	PAR-CLIP	20371350
MIRT565234	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT565233	hsa-miR-3689d	PAR-CLIP	20371350
MIRT565232	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT565231	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT565230	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT565229	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT565228	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT565227	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT565226	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT130055	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT482826	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT130042	hsa-miR-1253	PAR-CLIP	23592263
MIRT482825	hsa-miR-4419a	PAR-CLIP	23592263
MIRT482824	hsa-miR-4510	PAR-CLIP	23592263
MIRT482822	hsa-miR-6127	PAR-CLIP	23592263
MIRT482823	hsa-miR-6129	PAR-CLIP	23592263
MIRT482821	hsa-miR-6130	PAR-CLIP	23592263
MIRT482820	hsa-miR-6133	PAR-CLIP	23592263
MIRT482819	hsa-miR-4434	PAR-CLIP	23592263
MIRT482818	hsa-miR-4516	PAR-CLIP	23592263
MIRT482817	hsa-miR-5703	PAR-CLIP	23592263
MIRT482816	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT482815	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT482813	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT482814	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT482812	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT482811	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT482810	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT482809	hsa-miR-3175	PAR-CLIP	23592263
MIRT482808	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT482807	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT482806	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT482805	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT482803	hsa-miR-6745	PAR-CLIP	23592263
MIRT482804	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT482802	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT482801	hsa-miR-1293	PAR-CLIP	23592263
MIRT482800	hsa-miR-4483	PAR-CLIP	23592263
MIRT482799	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT482798	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT482797	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT482796	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT482794	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT482795	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT482793	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT482792	hsa-miR-3202	PAR-CLIP	23592263
MIRT383128	hsa-miR-5692a	PAR-CLIP	22100165
MIRT449133	hsa-miR-3163	PAR-CLIP	22100165
MIRT383129	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT449132	hsa-miR-1827	PAR-CLIP	22100165
MIRT449131	hsa-miR-633	PAR-CLIP	22100165
MIRT449130	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT449129	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT449128	hsa-miR-6869-5p	PAR-CLIP	22100165
MIRT449127	hsa-miR-6083	PAR-CLIP	22100165
MIRT449126	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT439396	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT439396	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT000711	hsa-miR-146a-5p	Next Generation Sequencing (NGS), Northern blot, pSILAC	26151128
MIRT000711	hsa-miR-146a-5p	Next Generation Sequencing (NGS), Northern blot, pSILAC	26151128
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26320176
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26320176
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26320176
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26320176
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26320176
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26320176
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26320176
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26320176
MIRT732113	mmu-miR-146a-3p	qRT-PCR, Western blot	28161709
MIRT732113	mmu-miR-146a-3p	qRT-PCR, Western blot	28161709
MIRT000711	hsa-miR-146a-5p	qRT-PCR, Western blot	25889446
MIRT000711	hsa-miR-146a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27904767
MIRT000711	hsa-miR-146a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27904767
MIRT565239	hsa-miR-1225-3p	PAR-CLIP	26701625
MIRT565239	hsa-miR-1225-3p	PAR-CLIP	26701625
MIRT565238	hsa-miR-1233-3p	PAR-CLIP	26701625
MIRT565238	hsa-miR-1233-3p	PAR-CLIP	26701625
MIRT565240	hsa-miR-1247-3p	PAR-CLIP	26701625
MIRT565240	hsa-miR-1247-3p	PAR-CLIP	26701625
MIRT565233	hsa-miR-3689d	PAR-CLIP	26701625
MIRT565233	hsa-miR-3689d	PAR-CLIP	26701625
MIRT565236	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT565236	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT565241	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT565241	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT565227	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT565227	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT565235	hsa-miR-6086	PAR-CLIP	26701625
MIRT565235	hsa-miR-6086	PAR-CLIP	26701625
MIRT565237	hsa-miR-6134	PAR-CLIP	26701625
MIRT565237	hsa-miR-6134	PAR-CLIP	26701625
MIRT565234	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT565234	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT565226	hsa-miR-6516-5p	PAR-CLIP	26701625
MIRT565226	hsa-miR-6516-5p	PAR-CLIP	26701625
MIRT565231	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT565231	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT565228	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT565228	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT565232	hsa-miR-6851-5p	PAR-CLIP	26701625
MIRT565232	hsa-miR-6851-5p	PAR-CLIP	26701625
MIRT565230	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT565230	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT565229	hsa-miR-7847-3p	PAR-CLIP	26701625
MIRT565229	hsa-miR-7847-3p	PAR-CLIP	26701625
MIRT000711	hsa-miR-146a-5p	ChIP-seq, ELISA, qRT-PCR	34203452
MIRT000711	hsa-miR-146a-5p	Immunohistochemistry (IHC), In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	33897883
MIRT005394	hsa-miR-146b-5p	Immunohistochemistry (IHC), In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	33897883
MIRT734332	hsa-miR-143-3p	ELISA, qRT-PCR	33430976
MIRT734333	hsa-miR-146a-3p	ELISA, qRT-PCR	33430976
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	33459883
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry	32328683
MIRT735423	hsa-miR-125b-5p	qRT-PCR	32039213
MIRT735589	hsa-miR-590-3p	Luciferase reporter assay, Western blotting, Microarray	32123831
MIRT734333	hsa-miR-146a-3p	Western blotting, qRT-PCR, Flow cytometry, ELISA	32117283
MIRT736444	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT736519	hsa-miR-140-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31882548
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), RNA-seq, qRT-PCR, Flow cytometry	32226532
MIRT736519	hsa-miR-140-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31882548
MIRT565241	hsa-miR-3940-3p	PAR-CLIP	20371350
MIRT565240	hsa-miR-1247-3p	PAR-CLIP	20371350
MIRT565239	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT565238	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT565237	hsa-miR-6134	PAR-CLIP	20371350
MIRT565236	hsa-miR-377-5p	PAR-CLIP	20371350
MIRT565235	hsa-miR-6086	PAR-CLIP	20371350
MIRT565234	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT565233	hsa-miR-3689d	PAR-CLIP	20371350
MIRT565232	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT565231	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT565230	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT565229	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT565228	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT565227	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT565226	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT130055	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT482826	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT130042	hsa-miR-1253	PAR-CLIP	23592263
MIRT482825	hsa-miR-4419a	PAR-CLIP	23592263
MIRT482824	hsa-miR-4510	PAR-CLIP	23592263
MIRT482822	hsa-miR-6127	PAR-CLIP	23592263
MIRT482823	hsa-miR-6129	PAR-CLIP	23592263
MIRT482821	hsa-miR-6130	PAR-CLIP	23592263
MIRT482820	hsa-miR-6133	PAR-CLIP	23592263
MIRT482819	hsa-miR-4434	PAR-CLIP	23592263
MIRT482818	hsa-miR-4516	PAR-CLIP	23592263
MIRT482817	hsa-miR-5703	PAR-CLIP	23592263
MIRT482816	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT482815	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT482813	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT482814	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT482812	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT482811	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT482810	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT482809	hsa-miR-3175	PAR-CLIP	23592263
MIRT482808	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT482807	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT482806	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT482805	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT482803	hsa-miR-6745	PAR-CLIP	23592263
MIRT482804	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT482802	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT482801	hsa-miR-1293	PAR-CLIP	23592263
MIRT482800	hsa-miR-4483	PAR-CLIP	23592263
MIRT482799	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT482798	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT482797	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT482796	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT482794	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT482795	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT482793	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT482792	hsa-miR-3202	PAR-CLIP	23592263
MIRT383128	hsa-miR-5692a	PAR-CLIP	22100165
MIRT449133	hsa-miR-3163	PAR-CLIP	22100165
MIRT383129	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT449132	hsa-miR-1827	PAR-CLIP	22100165
MIRT449131	hsa-miR-633	PAR-CLIP	22100165
MIRT449130	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT449129	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT449128	hsa-miR-6869-5p	PAR-CLIP	22100165
MIRT449127	hsa-miR-6083	PAR-CLIP	22100165
MIRT449126	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT755561	miR-495-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35784154
MIRT755561	miR-495-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35784154
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence	37391426
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35777802
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36175984
MIRT000711	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35240920
MIRT1451095	hsa-miR-1208	CLIP-seq
MIRT1451096	hsa-miR-1229	CLIP-seq
MIRT1451097	hsa-miR-1233	CLIP-seq
MIRT1451098	hsa-miR-124	CLIP-seq
MIRT1451099	hsa-miR-1258	CLIP-seq
MIRT1451100	hsa-miR-1273f	CLIP-seq
MIRT1451101	hsa-miR-135a	CLIP-seq
MIRT1451102	hsa-miR-135b	CLIP-seq
MIRT1451103	hsa-miR-143	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT1451107	hsa-miR-181a	CLIP-seq
MIRT1451108	hsa-miR-181b	CLIP-seq
MIRT1451109	hsa-miR-181c	CLIP-seq
MIRT1451110	hsa-miR-181d	CLIP-seq
MIRT1451111	hsa-miR-1914	CLIP-seq
MIRT1451112	hsa-miR-1915	CLIP-seq
MIRT1451113	hsa-miR-194	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT1451115	hsa-miR-197	CLIP-seq
MIRT1451116	hsa-miR-2115	CLIP-seq
MIRT1451117	hsa-miR-218	CLIP-seq
MIRT1451118	hsa-miR-219-5p	CLIP-seq
MIRT1451119	hsa-miR-302a	CLIP-seq
MIRT1451120	hsa-miR-302b	CLIP-seq
MIRT1451121	hsa-miR-302c	CLIP-seq
MIRT1451122	hsa-miR-302d	CLIP-seq
MIRT1451123	hsa-miR-302e	CLIP-seq
MIRT1451124	hsa-miR-3064-3p	CLIP-seq
MIRT1451125	hsa-miR-3148	CLIP-seq
MIRT1451126	hsa-miR-3185	CLIP-seq
MIRT1451127	hsa-miR-3187-3p	CLIP-seq
MIRT1451128	hsa-miR-34b	CLIP-seq
MIRT1451129	hsa-miR-3663-5p	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451132	hsa-miR-3691-5p	CLIP-seq
MIRT1451133	hsa-miR-370	CLIP-seq
MIRT1451134	hsa-miR-3714	CLIP-seq
MIRT1451135	hsa-miR-372	CLIP-seq
MIRT1451136	hsa-miR-373	CLIP-seq
MIRT1451137	hsa-miR-3911	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451139	hsa-miR-421	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451141	hsa-miR-4251	CLIP-seq
MIRT1451142	hsa-miR-4261	CLIP-seq
MIRT1451143	hsa-miR-4262	CLIP-seq
MIRT1451144	hsa-miR-4272	CLIP-seq
MIRT1451145	hsa-miR-4280	CLIP-seq
MIRT1451146	hsa-miR-4289	CLIP-seq
MIRT1451147	hsa-miR-4320	CLIP-seq
MIRT1451148	hsa-miR-4330	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451150	hsa-miR-4435	CLIP-seq
MIRT1451151	hsa-miR-4445	CLIP-seq
MIRT1451152	hsa-miR-4464	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT1451154	hsa-miR-4519	CLIP-seq
MIRT1451155	hsa-miR-452	CLIP-seq
MIRT1451156	hsa-miR-4532	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT1451158	hsa-miR-4663	CLIP-seq
MIRT1451159	hsa-miR-4676-3p	CLIP-seq
MIRT1451160	hsa-miR-4701-5p	CLIP-seq
MIRT1451161	hsa-miR-4708-5p	CLIP-seq
MIRT1451162	hsa-miR-4709-5p	CLIP-seq
MIRT1451163	hsa-miR-4722-5p	CLIP-seq
MIRT1451164	hsa-miR-4726-3p	CLIP-seq
MIRT1451165	hsa-miR-4748	CLIP-seq
MIRT1451166	hsa-miR-4752	CLIP-seq
MIRT1451167	hsa-miR-4755-3p	CLIP-seq
MIRT1451168	hsa-miR-4768-3p	CLIP-seq
MIRT1451169	hsa-miR-4770	CLIP-seq
MIRT1451170	hsa-miR-4775	CLIP-seq
MIRT1451171	hsa-miR-4781-3p	CLIP-seq
MIRT1451172	hsa-miR-4782-3p	CLIP-seq
MIRT1451173	hsa-miR-4795-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT1451176	hsa-miR-498	CLIP-seq
MIRT1451177	hsa-miR-506	CLIP-seq
MIRT1451178	hsa-miR-508-3p	CLIP-seq
MIRT1451179	hsa-miR-5096	CLIP-seq
MIRT1451180	hsa-miR-512-3p	CLIP-seq
MIRT1451181	hsa-miR-513a-3p	CLIP-seq
MIRT1451182	hsa-miR-513a-5p	CLIP-seq
MIRT1451183	hsa-miR-516a-3p	CLIP-seq
MIRT1451184	hsa-miR-520a-3p	CLIP-seq
MIRT1451185	hsa-miR-520b	CLIP-seq
MIRT1451186	hsa-miR-520c-3p	CLIP-seq
MIRT1451187	hsa-miR-520d-3p	CLIP-seq
MIRT1451188	hsa-miR-520e	CLIP-seq
MIRT1451189	hsa-miR-539	CLIP-seq
MIRT1451190	hsa-miR-548a-3p	CLIP-seq
MIRT1451191	hsa-miR-548ae	CLIP-seq
MIRT1451192	hsa-miR-548aj	CLIP-seq
MIRT1451193	hsa-miR-548am	CLIP-seq
MIRT1451194	hsa-miR-548an	CLIP-seq
MIRT1451195	hsa-miR-548e	CLIP-seq
MIRT1451196	hsa-miR-548f	CLIP-seq
MIRT1451197	hsa-miR-548s	CLIP-seq
MIRT1451198	hsa-miR-548x	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT1451200	hsa-miR-579	CLIP-seq
MIRT1451201	hsa-miR-588	CLIP-seq
MIRT1451202	hsa-miR-628-5p	CLIP-seq
MIRT1451203	hsa-miR-636	CLIP-seq
MIRT1451204	hsa-miR-649	CLIP-seq
MIRT1451205	hsa-miR-664	CLIP-seq
MIRT1451206	hsa-miR-873	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451208	hsa-miR-944	CLIP-seq
MIRT1451209	hsa-miR-1246	CLIP-seq
MIRT1451210	hsa-miR-146a	CLIP-seq
MIRT1451211	hsa-miR-198	CLIP-seq
MIRT1451212	hsa-miR-3134	CLIP-seq
MIRT1451213	hsa-miR-33a	CLIP-seq
MIRT1451214	hsa-miR-33b	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451133	hsa-miR-370	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451215	hsa-miR-3942-3p	CLIP-seq
MIRT1451141	hsa-miR-4251	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451216	hsa-miR-4461	CLIP-seq
MIRT1451217	hsa-miR-4469	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT1451158	hsa-miR-4663	CLIP-seq
MIRT1451163	hsa-miR-4722-5p	CLIP-seq
MIRT1451168	hsa-miR-4768-3p	CLIP-seq
MIRT1451218	hsa-miR-4773	CLIP-seq
MIRT1451219	hsa-miR-483-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451189	hsa-miR-539	CLIP-seq
MIRT1451194	hsa-miR-548an	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT1451220	hsa-miR-580	CLIP-seq
MIRT1451221	hsa-miR-586	CLIP-seq
MIRT1451222	hsa-miR-589	CLIP-seq
MIRT1451223	hsa-miR-642a	CLIP-seq
MIRT1451224	hsa-miR-651	CLIP-seq
MIRT1451225	hsa-miR-759	CLIP-seq
MIRT1451226	hsa-miR-767-5p	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451144	hsa-miR-4272	CLIP-seq
MIRT1555185	hsa-miR-637	CLIP-seq
MIRT1920997	hsa-miR-4742-3p	CLIP-seq
MIRT1451173	hsa-miR-4795-3p	CLIP-seq
MIRT1451099	hsa-miR-1258	CLIP-seq
MIRT2134840	hsa-miR-1298	CLIP-seq
MIRT1451210	hsa-miR-146a	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT2134841	hsa-miR-1908	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT2134842	hsa-miR-3120-3p	CLIP-seq
MIRT2134843	hsa-miR-3158-3p	CLIP-seq
MIRT2134844	hsa-miR-3158-5p	CLIP-seq
MIRT2134845	hsa-miR-3165	CLIP-seq
MIRT2134846	hsa-miR-323-3p	CLIP-seq
MIRT2134847	hsa-miR-3622b-5p	CLIP-seq
MIRT2134848	hsa-miR-3656	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451134	hsa-miR-3714	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451139	hsa-miR-421	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451141	hsa-miR-4251	CLIP-seq
MIRT1451144	hsa-miR-4272	CLIP-seq
MIRT2134849	hsa-miR-4283	CLIP-seq
MIRT2134850	hsa-miR-4307	CLIP-seq
MIRT1451147	hsa-miR-4320	CLIP-seq
MIRT1451148	hsa-miR-4330	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT2134851	hsa-miR-4489	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT2134852	hsa-miR-4656	CLIP-seq
MIRT2134853	hsa-miR-4704-5p	CLIP-seq
MIRT1451162	hsa-miR-4709-5p	CLIP-seq
MIRT2134854	hsa-miR-4731-5p	CLIP-seq
MIRT2134855	hsa-miR-4766-5p	CLIP-seq
MIRT2134856	hsa-miR-485-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT2134857	hsa-miR-548aa	CLIP-seq
MIRT2134858	hsa-miR-548t	CLIP-seq
MIRT2134859	hsa-miR-548v	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT2134860	hsa-miR-561	CLIP-seq
MIRT2134861	hsa-miR-570	CLIP-seq
MIRT2134862	hsa-miR-576-3p	CLIP-seq
MIRT1451222	hsa-miR-589	CLIP-seq
MIRT2134863	hsa-miR-663	CLIP-seq
MIRT2134864	hsa-miR-720	CLIP-seq
MIRT2134865	hsa-miR-888	CLIP-seq
MIRT2134866	hsa-miR-889	CLIP-seq
MIRT2134867	hsa-miR-939	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451098	hsa-miR-124	CLIP-seq
MIRT2134840	hsa-miR-1298	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451141	hsa-miR-4251	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT1451177	hsa-miR-506	CLIP-seq
MIRT1451097	hsa-miR-1233	CLIP-seq
MIRT2356097	hsa-miR-1245b-3p	CLIP-seq
MIRT1451100	hsa-miR-1273f	CLIP-seq
MIRT1451103	hsa-miR-143	CLIP-seq
MIRT1451115	hsa-miR-197	CLIP-seq
MIRT2356098	hsa-miR-2278	CLIP-seq
MIRT2356099	hsa-miR-2467-3p	CLIP-seq
MIRT1451124	hsa-miR-3064-3p	CLIP-seq
MIRT1451125	hsa-miR-3148	CLIP-seq
MIRT2134844	hsa-miR-3158-5p	CLIP-seq
MIRT2356100	hsa-miR-331-3p	CLIP-seq
MIRT2134848	hsa-miR-3656	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451132	hsa-miR-3691-5p	CLIP-seq
MIRT2356101	hsa-miR-3923	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT2134849	hsa-miR-4283	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT2356102	hsa-miR-4468	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT2134851	hsa-miR-4489	CLIP-seq
MIRT2356103	hsa-miR-4645-3p	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT2134852	hsa-miR-4656	CLIP-seq
MIRT1451161	hsa-miR-4708-5p	CLIP-seq
MIRT2134854	hsa-miR-4731-5p	CLIP-seq
MIRT1451167	hsa-miR-4755-3p	CLIP-seq
MIRT1451169	hsa-miR-4770	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451179	hsa-miR-5096	CLIP-seq
MIRT1451190	hsa-miR-548a-3p	CLIP-seq
MIRT2134857	hsa-miR-548aa	CLIP-seq
MIRT1451195	hsa-miR-548e	CLIP-seq
MIRT1451196	hsa-miR-548f	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT2134861	hsa-miR-570	CLIP-seq
MIRT2134864	hsa-miR-720	CLIP-seq
MIRT1451226	hsa-miR-767-5p	CLIP-seq
MIRT2356104	hsa-miR-890	CLIP-seq
MIRT2356105	hsa-miR-942	CLIP-seq
MIRT1451104	hsa-miR-15a	CLIP-seq
MIRT1451105	hsa-miR-15b	CLIP-seq
MIRT1451106	hsa-miR-16	CLIP-seq
MIRT1451114	hsa-miR-195	CLIP-seq
MIRT2396269	hsa-miR-3616-3p	CLIP-seq
MIRT1451140	hsa-miR-424	CLIP-seq
MIRT1451145	hsa-miR-4280	CLIP-seq
MIRT2396270	hsa-miR-4446-5p	CLIP-seq
MIRT2396271	hsa-miR-4457	CLIP-seq
MIRT1451152	hsa-miR-4464	CLIP-seq
MIRT1451154	hsa-miR-4519	CLIP-seq
MIRT1451165	hsa-miR-4748	CLIP-seq
MIRT2396272	hsa-miR-4755-5p	CLIP-seq
MIRT1451175	hsa-miR-497	CLIP-seq
MIRT2396273	hsa-miR-516a-5p	CLIP-seq
MIRT1451206	hsa-miR-873	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT1451097	hsa-miR-1233	CLIP-seq
MIRT2649608	hsa-miR-1273e	CLIP-seq
MIRT1451101	hsa-miR-135a	CLIP-seq
MIRT1451102	hsa-miR-135b	CLIP-seq
MIRT2134841	hsa-miR-1908	CLIP-seq
MIRT2649609	hsa-miR-202	CLIP-seq
MIRT1451118	hsa-miR-219-5p	CLIP-seq
MIRT2649610	hsa-miR-3065-5p	CLIP-seq
MIRT2649611	hsa-miR-3122	CLIP-seq
MIRT2649612	hsa-miR-3128	CLIP-seq
MIRT2649613	hsa-miR-3197	CLIP-seq
MIRT2134848	hsa-miR-3656	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT2649614	hsa-miR-3913-5p	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451142	hsa-miR-4261	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451151	hsa-miR-4445	CLIP-seq
MIRT2649615	hsa-miR-4470	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT2649616	hsa-miR-4536	CLIP-seq
MIRT2649617	hsa-miR-4637	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT2649618	hsa-miR-4681	CLIP-seq
MIRT1451163	hsa-miR-4722-5p	CLIP-seq
MIRT1451167	hsa-miR-4755-3p	CLIP-seq
MIRT2649619	hsa-miR-4767	CLIP-seq
MIRT1451168	hsa-miR-4768-3p	CLIP-seq
MIRT1451170	hsa-miR-4775	CLIP-seq
MIRT1451171	hsa-miR-4781-3p	CLIP-seq
MIRT1451172	hsa-miR-4782-3p	CLIP-seq
MIRT1451219	hsa-miR-483-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451178	hsa-miR-508-3p	CLIP-seq
MIRT1451179	hsa-miR-5096	CLIP-seq
MIRT2649620	hsa-miR-548k	CLIP-seq
MIRT2649621	hsa-miR-548p	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT2649622	hsa-miR-556-5p	CLIP-seq
MIRT2649623	hsa-miR-564	CLIP-seq
MIRT2649624	hsa-miR-582-3p	CLIP-seq
MIRT2649625	hsa-miR-583	CLIP-seq
MIRT2649626	hsa-miR-593	CLIP-seq
MIRT2649627	hsa-miR-624	CLIP-seq
MIRT1451202	hsa-miR-628-5p	CLIP-seq
MIRT2134863	hsa-miR-663	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq
MIRT1451097	hsa-miR-1233	CLIP-seq
MIRT2694050	hsa-miR-1268	CLIP-seq
MIRT2694051	hsa-miR-1268b	CLIP-seq
MIRT1451101	hsa-miR-135a	CLIP-seq
MIRT1451102	hsa-miR-135b	CLIP-seq
MIRT2134841	hsa-miR-1908	CLIP-seq
MIRT1451118	hsa-miR-219-5p	CLIP-seq
MIRT2694052	hsa-miR-3613-3p	CLIP-seq
MIRT2134848	hsa-miR-3656	CLIP-seq
MIRT1451130	hsa-miR-3689a-3p	CLIP-seq
MIRT1451131	hsa-miR-3689c	CLIP-seq
MIRT1451138	hsa-miR-3929	CLIP-seq
MIRT1451142	hsa-miR-4261	CLIP-seq
MIRT1451149	hsa-miR-4419b	CLIP-seq
MIRT1451151	hsa-miR-4445	CLIP-seq
MIRT1451153	hsa-miR-4478	CLIP-seq
MIRT2694053	hsa-miR-4486	CLIP-seq
MIRT2649616	hsa-miR-4536	CLIP-seq
MIRT1451157	hsa-miR-4649-3p	CLIP-seq
MIRT2649618	hsa-miR-4681	CLIP-seq
MIRT2694054	hsa-miR-4698	CLIP-seq
MIRT1451163	hsa-miR-4722-5p	CLIP-seq
MIRT2134854	hsa-miR-4731-5p	CLIP-seq
MIRT1451167	hsa-miR-4755-3p	CLIP-seq
MIRT1451168	hsa-miR-4768-3p	CLIP-seq
MIRT1451170	hsa-miR-4775	CLIP-seq
MIRT1451171	hsa-miR-4781-3p	CLIP-seq
MIRT1451172	hsa-miR-4782-3p	CLIP-seq
MIRT1451174	hsa-miR-485-5p	CLIP-seq
MIRT1451178	hsa-miR-508-3p	CLIP-seq
MIRT1451199	hsa-miR-550a	CLIP-seq
MIRT2649622	hsa-miR-556-5p	CLIP-seq
MIRT2649623	hsa-miR-564	CLIP-seq
MIRT2694055	hsa-miR-585	CLIP-seq
MIRT2649626	hsa-miR-593	CLIP-seq
MIRT2649627	hsa-miR-624	CLIP-seq
MIRT1451202	hsa-miR-628-5p	CLIP-seq
MIRT2134863	hsa-miR-663	CLIP-seq
MIRT1451207	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
RUNX3	Activation	17956589

Show/Hide all(97)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18093978
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0000209	Process	Protein polyubiquitination	IDA	15125833, 19675569
GO:0001503	Process	Ossification	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002726	Process	Positive regulation of T cell cytokine production	IMP	15125833
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0004842	Function	Ubiquitin-protein transferase activity	EXP	15361868, 17135271
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA	21873635
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005164	Function	Tumor necrosis factor receptor binding	IBA	21873635
GO:0005164	Function	Tumor necrosis factor receptor binding	IPI	11728344
GO:0005515	Function	Protein binding	IPI	10094049, 10465784, 10514511, 10920205, 11238466, 11244088, 11279055, 11397809, 11463333, 11518704, 11751921, 12140561, 12242293, 12270937, 12459498, 12496252, 12925853, 14982987, 15121867, 15125833, 15280356, 15998638, 16189514, 16286467, 16378096, 16874300, 16932746, 17124500, 173
GO:0005634	Component	Nucleus	IDA	18093978
GO:0005737	Component	Cytoplasm	IDA	16378096, 18093978
GO:0005811	Component	Lipid droplet	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	18093978
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IEA
GO:0006974	Process	Cellular response to DNA damage stimulus	IEA
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007250	Process	Activation of NF-kappaB-inducing kinase activity	IMP	15125833
GO:0007254	Process	JNK cascade	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0010008	Component	Endosome membrane	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0019901	Function	Protein kinase binding	IPI	19713527
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031293	Process	Membrane protein intracellular domain proteolysis	TAS
GO:0031398	Process	Positive regulation of protein ubiquitination	NAS	22412986
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IPI	10094049
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IDA	23776175
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0031996	Function	Thioesterase binding	IPI	11279055
GO:0032147	Process	Activation of protein kinase activity	IDA	17135271
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	15125833
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032991	Component	Protein-containing complex	IDA	23776175
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IBA	21873635
GO:0034162	Process	Toll-like receptor 9 signaling pathway	TAS
GO:0035631	Component	CD40 receptor complex	ISS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042088	Process	T-helper 1 type immune response	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042802	Function	Identical protein binding	IPI	19465916, 21988832, 22493164, 25416956, 27107012, 32296183
GO:0042826	Function	Histone deacetylase binding	IPI	18093978
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043122	Process	Regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	17135271
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	TAS
GO:0043422	Function	Protein kinase B binding	IPI	19713527
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	11751921
GO:0043507	Process	Positive regulation of JUN kinase activity	NAS	17135271
GO:0045453	Process	Bone resorption	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17135271
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IMP	18093978
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11751921
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	22412986
GO:0046330	Process	Positive regulation of JNK cascade	IBA	21873635
GO:0047485	Function	Protein N-terminus binding	IPI	14530355
GO:0048468	Process	Cell development	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11751921
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050852	Process	T cell receptor signaling pathway	IMP	15125833
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	12296995
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	11279055, 11751921, 16378096
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	12296995
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS
GO:0051865	Process	Protein autoubiquitination	IDA	17135271, 18093978, 23776175
GO:0051865	Process	Protein autoubiquitination	TAS	16378096
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	15125833, 17135271, 19713527
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IBA	21873635
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070534	Process	Protein K63-linked ubiquitination	IBA	21873635
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	19713527, 21068390
GO:0070534	Process	Protein K63-linked ubiquitination	IGI	17135271, 19675569
GO:0070555	Process	Response to interleukin-1	IDA	17135271
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23776175
GO:0071345	Process	Cellular response to cytokine stimulus	IMP	25515214
GO:0098802	Component	Plasma membrane signaling receptor complex	IBA	21873635
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IMP	25515214
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	25515214
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IDA	11751921

MIM	HGNC	e!Ensembl
602355	12036	ENSG00000175104

Protein

UniProt ID

Q9Y4K3

Protein name

TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)

Protein function

E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as ECSIT, IKBKG, IRAK1, AKT1 and AKT2 (PubMed:11057907, PubMed:18347055, PubMed:19465916, PubMe

PDB

1LB4 , 1LB5 , 1LB6 , 2ECI , 2JMD , 3HCS , 3HCT , 3HCU , 4Z8M , 5ZUJ , 6A33 , 7L3L , 8HZ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13923	zf-C3HC4_2	69 → 107		Domain
PF18048	TRAF6_Z2	157 → 183	TNF receptor-associated factor 6 zinc finger 2	Domain
PF02176	zf-TRAF	204 → 261	TRAF-type zinc finger	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence

MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV

Sequence length

522

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Hypohidrotic ectodermal dysplasia	autosomal dominant hypohidrotic ectodermal dysplasia	GenCC
Rheumatoid arthritis	Rheumatoid arthritis	GWAS

Show/Hide Text Mining Associations (103)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Stimulate	26475133
Acute Kidney Injury	Associate	34730059
Acute Lung Injury	Associate	22901274, 33123603
Adenocarcinoma of Lung	Associate	23055197
Alcoholism	Associate	38215866
Antiphospholipid Syndrome	Associate	12531807
Arthritis Rheumatoid	Associate	18759964, 19898481, 22231568, 22656185
Ascites	Associate	28687809
Atrial Fibrillation	Associate	28323847, 37169841
Bone Diseases	Associate	28122920
Breast Neoplasms	Associate	34036857
Bronchiolitis Obliterans Syndrome	Associate	25828101
Carcinogenesis	Associate	23055197, 24302991, 38245869
Carcinoma Hepatocellular	Associate	30281815, 30782845
Carcinoma Non Small Cell Lung	Stimulate	25605144
Carcinoma Renal Cell	Associate	38197755
Carcinoma Squamous Cell	Associate	22450746
Chronic Periodontitis	Associate	35034548
Colorectal Neoplasms	Associate	25242495, 31882548, 35179811
Corneal Endothelial Cell Loss	Associate	34369659
COVID 19	Associate	27164085, 37344097
Coxa Magna	Associate	38204239
Ectodermal Dysplasia 1 Anhidrotic	Associate	31652981
Esophageal Neoplasms	Stimulate	27697099
Familial cylindromatosis	Inhibit	16230348
Fibrocartilaginous embolism	Associate	28161709, 29038477
Fibrosis	Associate	28323847, 28687809, 37169841, 38215866
Glioblastoma	Associate	26320176
Glioma	Associate	26320176
Glomerulonephritis IGA	Associate	31974601
Graves Disease	Associate	28219358
Heart Diseases	Associate	30224945
Hematologic Diseases	Associate	37102608
Hepatitis B Chronic	Associate	24168509
Immune System Diseases	Associate	19898481, 40397075
Infections	Stimulate	32089541
Inflammation	Associate	16230348, 17114497, 18093978, 22656185, 23149220, 24107356, 25329999, 26308008, 28219358, 28338190, 31053727, 31882548, 32724027, 34672136, 35034548 View all (5 more)
Inflammatory Bowel Diseases	Associate	23431243
Inflammatory Bowel Diseases	Inhibit	26419460
Intervertebral Disc Degeneration	Associate	29038477
Invasive Pulmonary Aspergillosis	Associate	24274595
Ischemia	Associate	36449688
Kidney Failure Chronic	Stimulate	28549054
Leukemia Myeloid	Associate	35045331
Leukemia Myeloid Acute	Associate	22685174, 35045331
Lichen Planus Oral	Associate	34670484
Liver Cirrhosis	Associate	38215866
Lung Neoplasms	Stimulate	23055197
Lung Neoplasms	Associate	24321786, 25605144, 26847475, 27911870, 35422093
Lupus Erythematosus Systemic	Associate	22231568, 36177494, 38360126
Lupus Erythematosus Systemic	Stimulate	23497717
Lupus Nephritis	Inhibit	23896866
Lupus Nephritis	Associate	28338190
Lupus Nephritis	Stimulate	28549054
Lymphatic Metastasis	Associate	25605144, 35179811
Lymphoma	Associate	21041452
Malignant mesenchymal tumor	Associate	32436333
Melanoma Cutaneous Malignant	Associate	19626699
Mesothelioma Malignant	Associate	26254420
Mouth Neoplasms	Associate	29703234
Multiple Myeloma	Associate	17363736, 28122920, 30736330, 33323675
Muscle Neoplasms	Associate	33997016
Myasthenia Gravis	Associate	32210951
Myasthenia Gravis	Stimulate	33997016, 35978310
Myelodysplastic Syndromes	Associate	22685174, 37102608, 40397075
Myoma	Associate	21071347
Myositis	Associate	27388770
Neoplasm Metastasis	Associate	32436333, 35179811
Neoplasms	Associate	15142883, 20164024, 22450746, 23013936, 25605144, 26320176, 26583432, 26847475, 27697099, 28122920, 28981114, 29475459, 29703234, 30193098, 32384667, 32436333, 34036857, 35194034 View all (3 more)
Neoplasms	Stimulate	29729098
Neoplasms	Inhibit	35045331, 35179811
Neuroinflammatory Diseases	Associate	37344097
Osteoarthritis	Associate	28314786
Osteonecrosis	Stimulate	25820558
Osteoporosis	Associate	36311708
Osteosarcoma	Associate	35989576
Ovarian Neoplasms	Associate	36830707
Papillomavirus Infections	Associate	32089541, 33164635
Periodic fever familial autosomal dominant	Associate	31009059
Peritoneal Neoplasms	Associate	28687809
Peritonitis	Associate	28687809
Plasma Cell Granuloma Pulmonary	Associate	35238669
Pre Eclampsia	Associate	34493304
Prostatic Neoplasms	Associate	29202848, 33771884
Pulmonary Fibrosis	Associate	35238669
Pyruvate Carboxylase Deficiency Disease	Associate	29475459
Rheumatic Heart Disease	Associate	28323847
Sepsis	Associate	22901274, 24701036
Severe Acute Respiratory Syndrome	Associate	24701036
Sjogren's Syndrome	Associate	30446998
Small Cell Lung Carcinoma	Stimulate	25605144
Squamous Cell Carcinoma of Head and Neck	Associate	24302991, 24999832, 29703234
Squamous Cell Carcinoma of Head and Neck	Inhibit	24999832
Still's Disease Adult Onset	Stimulate	23497717
Stomach Neoplasms	Stimulate	23013936
Stomach Neoplasms	Associate	35240920, 35851310, 38062041
Synovitis	Associate	22656185
Systemic Inflammatory Response Syndrome	Associate	25984739
Thrombocytopenia	Associate	22231568
Tooth Resorption	Associate	24886600
Triple Negative Breast Neoplasms	Associate	40296903
Uterine Cervical Neoplasms	Associate	35194034
Weight Loss	Associate	23013936

TRAF6 (TNF receptor associated factor 6)