Gene Gene information from NCBI Gene database.
Entrez ID 7189
Gene name TNF receptor associated factor 6
Gene symbol TRAF6
Synonyms (NCBI Gene)
MGC:3310RNF85
Chromosome 11
Chromosome location 11p12
Summary The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from, members of the TNF receptor superfamily. This protein mediates signaling fro
miRNA miRNA information provided by mirtarbase database.
589
miRTarBase ID miRNA Experiments Reference
MIRT000711 hsa-miR-146a-5p Western blotNorthern blot 18504431
MIRT000711 hsa-miR-146a-5p Luciferase reporter assayWestern blot 20061417
MIRT000711 hsa-miR-146a-5p qRT-PCRflowLuciferase reporter assayWestern blot 20375304
MIRT000711 hsa-miR-146a-5p qRT-PCR 18759964
MIRT000711 hsa-miR-146a-5p ImmunoprecipitaionWestern blotCommunoprecipitaion 19898489
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
RUNX3 Activation 17956589
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
148
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IDA 20713597, 23202584, 23392225, 23524951, 25891078, 28890335, 33637724
GO:0000045 Process Autophagosome assembly IDA 23524951
GO:0000045 Process Autophagosome assembly IMP 30778222
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18093978
GO:0000209 Process Protein polyubiquitination IDA 15125833, 19675569
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602355 12036 ENSG00000175104
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y4K3
Protein name TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)
Protein function E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as ECSIT, IKBKG, IRAK1, AKT1 and AKT2 (PubMed:11057907, PubMed:18347055, PubMed:19465916, PubMe
PDB 1LB4 , 1LB5 , 1LB6 , 2ECI , 2JMD , 3HCS , 3HCT , 3HCU , 4Z8M , 5ZUJ , 6A33 , 7L3L , 8HZ2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13923 zf-C3HC4_2 69 107 Domain
PF18048 TRAF6_Z2 157 183 TNF receptor-associated factor 6 zinc finger 2 Domain
PF02176 zf-TRAF 204 261 TRAF-type zinc finger Family
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Sequence
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCP
RRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARH
LQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Sequence length 522
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
TRAF6-related disorder Likely benign rs145863131 RCV003949230
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Stimulate 26475133
Acute Kidney Injury Associate 34730059
Acute Lung Injury Associate 22901274, 33123603
Adenocarcinoma of Lung Associate 23055197
Alcoholism Associate 38215866
Antiphospholipid Syndrome Associate 12531807
Arthritis Rheumatoid Associate 18759964, 19898481, 22231568, 22656185
Ascites Associate 28687809
Atrial Fibrillation Associate 28323847, 37169841
Bone Diseases Associate 28122920