Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7186
Gene name	TNF receptor associated factor 2
Gene symbol	TRAF2
Synonyms (NCBI Gene)	MGC:45012RNF117TRAPTRAP3
Chromosome	9
Chromosome location	9q34.3
Summary	The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from members of the TNF receptor superfamily. This protein directly interacts with

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437984	hsa-miR-502-5p	qRT-PCRLuciferase reporter assayWestern blot	24677135
MIRT437984	hsa-miR-502-5p	qRT-PCRLuciferase reporter assayWestern blot	24677135
MIRT437984	hsa-miR-502-5p	qRT-PCRLuciferase reporter assayWestern blot	24677135
MIRT437984	hsa-miR-502-5p	qRT-PCRLuciferase reporter assayWestern blot	24677135
MIRT437984	hsa-miR-502-5p	qRT-PCRLuciferase reporter assayWestern blot	24677135
MIRT437984	hsa-miR-502-5p	qRT-PCRLuciferase reporter assayWestern blot	24677135
MIRT711869	hsa-miR-6165	HITS-CLIP	19536157
MIRT711868	hsa-miR-4695-5p	HITS-CLIP	19536157
MIRT711867	hsa-miR-4459	HITS-CLIP	19536157
MIRT711866	hsa-miR-4530	HITS-CLIP	19536157
MIRT711865	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT711864	hsa-miR-3690	HITS-CLIP	19536157
MIRT711863	hsa-miR-4254	HITS-CLIP	19536157
MIRT711862	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT711861	hsa-miR-1976	HITS-CLIP	19536157
MIRT711860	hsa-miR-5008-5p	HITS-CLIP	19536157
MIRT711859	hsa-miR-4722-5p	HITS-CLIP	19536157
MIRT711858	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT711857	hsa-miR-6081	HITS-CLIP	19536157
MIRT711856	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT711855	hsa-miR-4279	HITS-CLIP	19536157
MIRT491338	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT491337	hsa-miR-4519	PAR-CLIP	23592263
MIRT491336	hsa-miR-371a-5p	PAR-CLIP	23592263
MIRT437984	hsa-miR-502-5p	Luciferase reporter assay	26861148
MIRT734555	hsa-miR-532-3p	Luciferase reporter assayWestern blotting	32368615
MIRT437984	hsa-miR-502-5p	Luciferase reporter assayWestern blottingqRT-PCR	33869626
MIRT711869	hsa-miR-6165	HITS-CLIP	19536157
MIRT711868	hsa-miR-4695-5p	HITS-CLIP	19536157
MIRT711867	hsa-miR-4459	HITS-CLIP	19536157
MIRT711866	hsa-miR-4530	HITS-CLIP	19536157
MIRT711865	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT711864	hsa-miR-3690	HITS-CLIP	19536157
MIRT711863	hsa-miR-4254	HITS-CLIP	19536157
MIRT711862	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT711861	hsa-miR-1976	HITS-CLIP	19536157
MIRT711860	hsa-miR-5008-5p	HITS-CLIP	19536157
MIRT711859	hsa-miR-4722-5p	HITS-CLIP	19536157
MIRT711858	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT711857	hsa-miR-6081	HITS-CLIP	19536157
MIRT711856	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT711855	hsa-miR-4279	HITS-CLIP	19536157
MIRT491338	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT491337	hsa-miR-4519	PAR-CLIP	23592263
MIRT491336	hsa-miR-371a-5p	PAR-CLIP	23592263
MIRT755801	miR?361?3p	Luciferase reporter assayWestern blottingqRT-PCRELISARNA pull down assay	37614428
MIRT756159	hsa-miR-140-3p	Luciferase reporter assayWestern blotting	37346408
MIRT2134733	hsa-miR-2467-3p	CLIP-seq
MIRT2134734	hsa-miR-3194-5p	CLIP-seq
MIRT2134735	hsa-miR-3926	CLIP-seq
MIRT2134736	hsa-miR-4468	CLIP-seq
MIRT2134737	hsa-miR-4761-5p	CLIP-seq
MIRT2134738	hsa-miR-548s	CLIP-seq
MIRT2356019	hsa-miR-4287	CLIP-seq
MIRT2356020	hsa-miR-4420	CLIP-seq
MIRT2356021	hsa-miR-4436a	CLIP-seq
MIRT2356022	hsa-miR-4436b-3p	CLIP-seq
MIRT2356023	hsa-miR-4685-3p	CLIP-seq
MIRT2356024	hsa-miR-4700-3p	CLIP-seq
MIRT2462262	hsa-miR-214	CLIP-seq
MIRT2462263	hsa-miR-3176	CLIP-seq
MIRT2462264	hsa-miR-3194-3p	CLIP-seq
MIRT2462265	hsa-miR-3614-3p	CLIP-seq
MIRT2462266	hsa-miR-3619-5p	CLIP-seq
MIRT2462267	hsa-miR-3667-3p	CLIP-seq
MIRT2462268	hsa-miR-3922-3p	CLIP-seq
MIRT2462269	hsa-miR-4297	CLIP-seq
MIRT2462270	hsa-miR-4435	CLIP-seq
MIRT2462271	hsa-miR-761	CLIP-seq
MIRT2649480	hsa-miR-128	CLIP-seq
MIRT2649481	hsa-miR-188-3p	CLIP-seq
MIRT2649482	hsa-miR-1915	CLIP-seq
MIRT2462262	hsa-miR-214	CLIP-seq
MIRT2134733	hsa-miR-2467-3p	CLIP-seq
MIRT2649483	hsa-miR-3166	CLIP-seq
MIRT2462263	hsa-miR-3176	CLIP-seq
MIRT2462264	hsa-miR-3194-3p	CLIP-seq
MIRT2649484	hsa-miR-3545-5p	CLIP-seq
MIRT2462265	hsa-miR-3614-3p	CLIP-seq
MIRT2462266	hsa-miR-3619-5p	CLIP-seq
MIRT2649485	hsa-miR-3649	CLIP-seq
MIRT2462267	hsa-miR-3667-3p	CLIP-seq
MIRT2462268	hsa-miR-3922-3p	CLIP-seq
MIRT2649486	hsa-miR-3925-3p	CLIP-seq
MIRT2649487	hsa-miR-3944-5p	CLIP-seq
MIRT2356019	hsa-miR-4287	CLIP-seq
MIRT2462269	hsa-miR-4297	CLIP-seq
MIRT2649488	hsa-miR-4303	CLIP-seq
MIRT2462270	hsa-miR-4435	CLIP-seq
MIRT2649489	hsa-miR-4467	CLIP-seq
MIRT2134736	hsa-miR-4468	CLIP-seq
MIRT2649490	hsa-miR-4527	CLIP-seq
MIRT2649491	hsa-miR-4640-5p	CLIP-seq
MIRT2649492	hsa-miR-4648	CLIP-seq
MIRT2356023	hsa-miR-4685-3p	CLIP-seq
MIRT2649493	hsa-miR-4685-5p	CLIP-seq
MIRT2649494	hsa-miR-4726-5p	CLIP-seq
MIRT2649495	hsa-miR-4768-5p	CLIP-seq
MIRT2649496	hsa-miR-4771	CLIP-seq
MIRT2649497	hsa-miR-601	CLIP-seq
MIRT2462271	hsa-miR-761	CLIP-seq
MIRT2649498	hsa-miR-766	CLIP-seq
MIRT2649499	hsa-miR-942	CLIP-seq
MIRT2462262	hsa-miR-214	CLIP-seq
MIRT2462263	hsa-miR-3176	CLIP-seq
MIRT2462264	hsa-miR-3194-3p	CLIP-seq
MIRT2462265	hsa-miR-3614-3p	CLIP-seq
MIRT2462266	hsa-miR-3619-5p	CLIP-seq
MIRT2462267	hsa-miR-3667-3p	CLIP-seq
MIRT2462268	hsa-miR-3922-3p	CLIP-seq
MIRT2649486	hsa-miR-3925-3p	CLIP-seq
MIRT2356019	hsa-miR-4287	CLIP-seq
MIRT2462269	hsa-miR-4297	CLIP-seq
MIRT2462270	hsa-miR-4435	CLIP-seq
MIRT2649491	hsa-miR-4640-5p	CLIP-seq
MIRT2356023	hsa-miR-4685-3p	CLIP-seq
MIRT2649493	hsa-miR-4685-5p	CLIP-seq
MIRT2649494	hsa-miR-4726-5p	CLIP-seq
MIRT2649495	hsa-miR-4768-5p	CLIP-seq
MIRT2462271	hsa-miR-761	CLIP-seq
MIRT2649498	hsa-miR-766	CLIP-seq
MIRT2649499	hsa-miR-942	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
NFKB1	Activation	15041463
NFKB1	Repression	15723831
NFKB1	Unknown	19392652
RELA	Activation	15041463
RELA	Repression	15723831
RELA	Unknown	19392652

117

Show/Hide all (117)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IPI	17314283
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002700	Process	Regulation of production of molecular mediator of immune response	IEA
GO:0002726	Process	Positive regulation of T cell cytokine production	IMP	15125833
GO:0002947	Component	Tumor necrosis factor receptor superfamily complex	IDA	23429285
GO:0004842	Function	Ubiquitin-protein transferase activity	EXP	26620909
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	15258597, 20577214
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IBA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IPI	11279055, 11728344
GO:0005174	Function	CD40 receptor binding	IEA
GO:0005174	Function	CD40 receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	8069916, 8565075, 9020361, 9153189, 9162022, 9418902, 9692890, 10075662, 10514511, 10518213, 10521462, 10892748, 11278723, 11466612, 11777919, 11798190, 11907583, 14743216, 15121867, 16189514, 16282325, 16311516, 16636664, 16713569, 17389591, 19332782, 19805025, 20447407, 20562859, 2
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15383523, 19150425
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005938	Component	Cell cortex	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8702708
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IC	8565075
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0012501	Process	Programmed cell death	IEA
GO:0012506	Component	Vesicle membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	16636664
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	10650002
GO:0019903	Function	Protein phosphatase binding	IPI	15696169
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IEA
GO:0023035	Process	CD40 signaling pathway	IDA	15708970
GO:0030163	Process	Protein catabolic process	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	8565075, 38354704
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IPI	20447407
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	23951545
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0031996	Function	Thioesterase binding	IPI	11279055
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	15125833
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IBA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	11907583
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	12296995
GO:0034351	Process	Negative regulation of glial cell apoptotic process	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	NAS	10650002
GO:0035591	Function	Signaling adaptor activity	IBA
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0035631	Component	CD40 receptor complex	IEA
GO:0035631	Component	CD40 receptor complex	ISS
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	8565075
GO:0038202	Process	TORC1 signaling	IDA	26678875
GO:0038203	Process	TORC2 signaling	IDA	35926713
GO:0042110	Process	T cell activation	IDA	38354704
GO:0042110	Process	T cell activation	IDA	38354704
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	8069916, 9020361, 16189514, 20562859, 25416956, 30561431, 31515488, 32296183
GO:0042981	Process	Regulation of apoptotic process	IDA	11907583
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043120	Function	Tumor necrosis factor binding	IPI	23429285
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	12296995, 15121867
GO:0043235	Component	Receptor complex	IEA
GO:0043254	Process	Regulation of protein-containing complex assembly	IMP	11278723
GO:0043408	Process	Regulation of MAPK cascade	IEA
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	11907583
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IDA	23951545
GO:0045121	Component	Membrane raft	IEA
GO:0046328	Process	Regulation of JNK cascade	IEA
GO:0046328	Process	Regulation of JNK cascade	IEA
GO:0046625	Function	Sphingolipid binding	IDA	20577214
GO:0046872	Function	Metal ion binding	IEA
GO:0048255	Process	MRNA stabilization	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	15121867
GO:0051865	Process	Protein autoubiquitination	IDA	20577214
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0051865	Process	Protein autoubiquitination	TAS	16378096
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	20577214, 28489822
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	ISS
GO:0065003	Process	Protein-containing complex assembly	TAS	8702708
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	14685163, 22013210
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	15258597, 20577214, 28489822
GO:0070534	Process	Protein K63-linked ubiquitination	IEA
GO:0071732	Process	Cellular response to nitric oxide	IEA
GO:0097057	Component	TRAF2-GSTP1 complex	IDA	16636664
GO:0097300	Process	Programmed necrotic cell death	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:0160162	Process	CD27 signaling pathway	IDA	38354704
GO:0160162	Process	CD27 signaling pathway	IDA	38354704
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:1905669	Process	TORC1 complex assembly	IDA	28489822
GO:1905669	Process	TORC1 complex assembly	IEA
GO:1905670	Process	TORC2 complex disassembly	IDA	28489822
GO:1905670	Process	TORC2 complex disassembly	IEA
GO:1990604	Component	IRE1-TRAF2-ASK1 complex	IBA
GO:1990604	Component	IRE1-TRAF2-ASK1 complex	IDA	23000344
GO:1990604	Component	IRE1-TRAF2-ASK1 complex	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21525013

MIM	HGNC	e!Ensembl
601895	12032	ENSG00000127191

Q12933

Protein name

TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3)

Protein function

E3 ubiquitin-protein ligase that regulates activation of NF-kappa-B and JNK and plays a central role in the regulation of cell survival and apoptosis (PubMed:10346818, PubMed:11784851, PubMed:12917689, PubMed:15383523, PubMed:18981220, PubMed:19

PDB

1CA4 , 1CA9 , 1CZY , 1CZZ , 1D00 , 1D01 , 1D0A , 1D0J , 1F3V , 1QSC , 3KNV , 3M06 , 3M0A , 3M0D , 8T5Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00097	zf-C3HC4	34 → 72	Zinc finger, C3HC4 type (RING finger)	Domain
PF02176	zf-TRAF	178 → 235	TRAF-type zinc finger	Family
PF16673	TRAF_BIRC3_bd	267 → 330	TNF receptor-associated factor BIRC3 binding domain	Coiled-coil

Sequence

MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL

Sequence length

501

Interactions

View interactions

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs148192660	RCV005906122
Familial cancer of breast	Likely benign; Benign	rs201857326, rs148192660	RCV005926856 RCV005906121
Gastric cancer	Benign	rs148192660	RCV005906125
Hepatocellular carcinoma	Benign	rs148192660	RCV005906123
Lung cancer	Benign	rs148192660	RCV005906130
Malignant tumor of esophagus	Benign	rs148192660	RCV005906124
Melanoma	Benign	rs148192660	RCV005906129
Ovarian serous cystadenocarcinoma	Benign	rs148192660	RCV005906126
Thymoma	Benign	rs148192660	RCV005906127
Thyroid cancer, nonmedullary, 1	Benign	rs148192660	RCV005906128

Show/Hide Text Mining Associations (59)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alopecia Areata	Associate	20546884
Altitude Sickness	Associate	35668171
Arthritis Rheumatoid	Stimulate	16951485
Arthritis Rheumatoid	Associate	27534557, 32145086, 33483588
Atrial Fibrillation	Associate	26774166
Breast Neoplasms	Associate	26317411
Carcinoma Hepatocellular	Associate	28521610, 35855852, 37081115
Carcinoma Non Small Cell Lung	Associate	23188828
Carcinoma Ovarian Epithelial	Associate	24740199, 34071938
Carcinoma Pancreatic Ductal	Associate	23301098
Carcinoma Renal Cell	Stimulate	37415241
Colitis Ulcerative	Associate	23638224
Colorectal Neoplasms	Associate	26499327, 34257589
Death	Associate	31681304
Dermatitis Atopic 1	Stimulate	11207646
Drug Related Side Effects and Adverse Reactions	Associate	31524237
Drug Related Side Effects and Adverse Reactions	Inhibit	32238696
Epstein Barr Virus Infections	Associate	18230756
Fibrocartilaginous embolism	Associate	33869626
Fibrosarcoma	Associate	32238696
Fibrosis	Associate	37604222
Glioblastoma	Associate	22952576, 23775076, 28926524
Glioma	Associate	33920356
Head and Neck Neoplasms	Associate	22170762
Hereditary leiomyomatosis and renal cell cancer	Associate	12000717
Hodgkin Disease	Associate	10666192
HTLV I Infections	Associate	17409010
Inflammation	Associate	21820422, 26165383, 34980176
Inflammatory Bowel Diseases	Associate	23638224
Leukemia	Associate	10595933, 21820422
Leukemia Lymphocytic Chronic B Cell	Stimulate	12411322
Liver Diseases	Associate	26165383
Lung Diseases	Associate	26165383
Lung Neoplasms	Associate	38184997
Lymphatic Metastasis	Associate	26823737
Lymphoma	Associate	18230756
Lymphoma B Cell Marginal Zone	Associate	16512826
Lymphoma Large B Cell Diffuse	Associate	19412164
Lymphoproliferative Disorders	Associate	14521460
Mesothelioma Malignant	Associate	33800494
Microsatellite Instability	Associate	34257589
Multiple Myeloma	Associate	17692805, 21850048
Myoma	Associate	21071347
Neoplasm Metastasis	Associate	26823737, 37415241
Neoplasms	Associate	23051914, 23301098, 25337707, 27036023, 28315521, 28482915, 28855498, 29683819, 32810161, 34160069, 37081115, 37415241, 37983928
Neoplasms	Inhibit	34257589
Ovarian Neoplasms	Associate	35950370
Pancreatic Neoplasms	Associate	23301098
Pemphigus	Associate	31681304, 32926429
Postoperative Complications	Associate	26165383
Prostatic Neoplasms	Associate	19123467, 29151113
Prostatic Neoplasms	Stimulate	28855498
Squamous Cell Carcinoma of Head and Neck	Associate	36012427
Stomach Neoplasms	Associate	26823737, 28972304
Testicular Germ Cell Tumor	Associate	28471449
Thyroid Neoplasms	Associate	33879700
Triple Negative Breast Neoplasms	Associate	35631261, 37093683
Urethral Neoplasms	Associate	35659036
Vitiligo	Associate	24457966

TRAF2 (TNF receptor associated factor 2)