Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	8717
Gene name	TNFRSF1A associated via death domain
Gene symbol	TRADD
Synonyms (NCBI Gene)	Hs.89862
Chromosome	16
Chromosome location	16q22.1
Summary	The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of i

Show/Hide all (99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT495119	hsa-miR-4717-5p	PAR-CLIP	23708386
MIRT495118	hsa-miR-15a-3p	PAR-CLIP	23708386
MIRT495116	hsa-miR-1295b-3p	PAR-CLIP	23708386
MIRT495117	hsa-miR-922	PAR-CLIP	23708386
MIRT495115	hsa-miR-4530	PAR-CLIP	23708386
MIRT495114	hsa-miR-338-3p	PAR-CLIP	23708386
MIRT495113	hsa-miR-4480	PAR-CLIP	23708386
MIRT495112	hsa-miR-5704	PAR-CLIP	23708386
MIRT736442	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT495119	hsa-miR-4717-5p	PAR-CLIP	23708386
MIRT495118	hsa-miR-15a-3p	PAR-CLIP	23708386
MIRT495116	hsa-miR-1295b-3p	PAR-CLIP	23708386
MIRT495117	hsa-miR-922	PAR-CLIP	23708386
MIRT495115	hsa-miR-4530	PAR-CLIP	23708386
MIRT495114	hsa-miR-338-3p	PAR-CLIP	23708386
MIRT495113	hsa-miR-4480	PAR-CLIP	23708386
MIRT495112	hsa-miR-5704	PAR-CLIP	23708386
MIRT1450667	hsa-miR-103a	CLIP-seq
MIRT1450668	hsa-miR-107	CLIP-seq
MIRT1450669	hsa-miR-1184	CLIP-seq
MIRT1450670	hsa-miR-1197	CLIP-seq
MIRT1450671	hsa-miR-1205	CLIP-seq
MIRT1450672	hsa-miR-1252	CLIP-seq
MIRT1450673	hsa-miR-298	CLIP-seq
MIRT1450674	hsa-miR-3065-3p	CLIP-seq
MIRT1450675	hsa-miR-3158-5p	CLIP-seq
MIRT1450676	hsa-miR-3682-5p	CLIP-seq
MIRT1450677	hsa-miR-3914	CLIP-seq
MIRT1450678	hsa-miR-3942-5p	CLIP-seq
MIRT1450679	hsa-miR-4291	CLIP-seq
MIRT1450680	hsa-miR-4418	CLIP-seq
MIRT1450681	hsa-miR-4420	CLIP-seq
MIRT1450682	hsa-miR-4436a	CLIP-seq
MIRT1450683	hsa-miR-4520a-3p	CLIP-seq
MIRT1450684	hsa-miR-4529-5p	CLIP-seq
MIRT1450685	hsa-miR-4686	CLIP-seq
MIRT1450686	hsa-miR-4703-5p	CLIP-seq
MIRT1450687	hsa-miR-4753-5p	CLIP-seq
MIRT1450688	hsa-miR-509-3-5p	CLIP-seq
MIRT1450689	hsa-miR-509-5p	CLIP-seq
MIRT1450690	hsa-miR-545	CLIP-seq
MIRT1450691	hsa-miR-665	CLIP-seq
MIRT2134721	hsa-miR-1193	CLIP-seq
MIRT2134722	hsa-miR-3064-5p	CLIP-seq
MIRT2134723	hsa-miR-3691-5p	CLIP-seq
MIRT1450678	hsa-miR-3942-5p	CLIP-seq
MIRT2134724	hsa-miR-4281	CLIP-seq
MIRT1450679	hsa-miR-4291	CLIP-seq
MIRT1450683	hsa-miR-4520a-3p	CLIP-seq
MIRT1450686	hsa-miR-4703-5p	CLIP-seq
MIRT2134725	hsa-miR-515-5p	CLIP-seq
MIRT1450690	hsa-miR-545	CLIP-seq
MIRT2134724	hsa-miR-4281	CLIP-seq
MIRT1450672	hsa-miR-1252	CLIP-seq
MIRT1450673	hsa-miR-298	CLIP-seq
MIRT2134722	hsa-miR-3064-5p	CLIP-seq
MIRT2649470	hsa-miR-3192	CLIP-seq
MIRT1450678	hsa-miR-3942-5p	CLIP-seq
MIRT1450679	hsa-miR-4291	CLIP-seq
MIRT2649471	hsa-miR-4314	CLIP-seq
MIRT2649472	hsa-miR-4446-3p	CLIP-seq
MIRT2649473	hsa-miR-4492	CLIP-seq
MIRT2649474	hsa-miR-4498	CLIP-seq
MIRT2649475	hsa-miR-4646-5p	CLIP-seq
MIRT2649476	hsa-miR-4687-3p	CLIP-seq
MIRT1450686	hsa-miR-4703-5p	CLIP-seq
MIRT2649477	hsa-miR-4738-3p	CLIP-seq
MIRT1450690	hsa-miR-545	CLIP-seq
MIRT2649478	hsa-miR-548g	CLIP-seq
MIRT2649479	hsa-miR-762	CLIP-seq
MIRT1450672	hsa-miR-1252	CLIP-seq
MIRT2694004	hsa-miR-2467-5p	CLIP-seq
MIRT1450673	hsa-miR-298	CLIP-seq
MIRT2134722	hsa-miR-3064-5p	CLIP-seq
MIRT2694005	hsa-miR-3188	CLIP-seq
MIRT2649470	hsa-miR-3192	CLIP-seq
MIRT2694006	hsa-miR-3929	CLIP-seq
MIRT1450678	hsa-miR-3942-5p	CLIP-seq
MIRT2694007	hsa-miR-3975	CLIP-seq
MIRT1450679	hsa-miR-4291	CLIP-seq
MIRT2649471	hsa-miR-4314	CLIP-seq
MIRT2694008	hsa-miR-4316	CLIP-seq
MIRT2694009	hsa-miR-4419b	CLIP-seq
MIRT2694010	hsa-miR-4434	CLIP-seq
MIRT2649472	hsa-miR-4446-3p	CLIP-seq
MIRT2694011	hsa-miR-4478	CLIP-seq
MIRT2649473	hsa-miR-4492	CLIP-seq
MIRT2649474	hsa-miR-4498	CLIP-seq
MIRT2694012	hsa-miR-4516	CLIP-seq
MIRT2649475	hsa-miR-4646-5p	CLIP-seq
MIRT2649476	hsa-miR-4687-3p	CLIP-seq
MIRT2694013	hsa-miR-4695-3p	CLIP-seq
MIRT1450686	hsa-miR-4703-5p	CLIP-seq
MIRT2694014	hsa-miR-4710	CLIP-seq
MIRT2649477	hsa-miR-4738-3p	CLIP-seq
MIRT2694015	hsa-miR-485-5p	CLIP-seq
MIRT1450690	hsa-miR-545	CLIP-seq
MIRT2649478	hsa-miR-548g	CLIP-seq
MIRT2649479	hsa-miR-762	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002947	Component	Tumor necrosis factor receptor superfamily complex	IBA
GO:0002947	Component	Tumor necrosis factor receptor superfamily complex	IDA	23429285
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IBA
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IPI	8612133
GO:0005515	Function	Protein binding	IPI	1040062, 7758105, 8565075, 8943045, 8985253, 9020361, 10848577, 10892748, 11112409, 11374864, 11684708, 14743216, 16611992, 18198944, 19379743, 19524513, 19641494, 19781631, 20628368, 22510408, 23429285, 23955153, 24025841, 24130170, 30561431, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	11684708, 22510408
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	22510408
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	7758105
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7758105
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IMP	25732226
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	TAS	8612133
GO:0009898	Component	Cytoplasmic side of plasma membrane	IC	7758105
GO:0019900	Function	Kinase binding	IPI	8612133
GO:0030335	Process	Positive regulation of cell migration	IMP	25732226
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	7758105
GO:0031264	Component	Death-inducing signaling complex	TAS	18309324
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	11907583
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	7758105
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEP	12761501
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	8612133
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0035591	Function	Signaling adaptor activity	ISS
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	21785459
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	9430228
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	8565075
GO:0042802	Function	Identical protein binding	IPI	7758105, 11684708, 30561431
GO:0043065	Process	Positive regulation of apoptotic process	TAS	18309324
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	15121867
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	TAS	18309324
GO:0043235	Component	Receptor complex	IDA	8612133
GO:0050729	Process	Positive regulation of inflammatory response	IMP	25732226
GO:0051798	Process	Positive regulation of hair follicle development	IEA
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0070513	Function	Death domain binding	IPI	8612133
GO:0071356	Process	Cellular response to tumor necrosis factor	IMP	25732226
GO:0097190	Process	Apoptotic signaling pathway	IDA	8565075
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	16611992
GO:0097191	Process	Extrinsic apoptotic signaling pathway	TAS	18309324

MIM	HGNC	e!Ensembl
603500	12030	ENSG00000102871

Q15628

Protein name

Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein) (TNFRSF1A-associated via death domain)

Protein function

Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD (PubMed:23955153, PubMed:7758105, PubMed:8612133). Overexpression of TRADD leads to two

PDB

1F2H , 1F3V , 5XME , 6AC0 , 7CSQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09034	TRADD_N	51 → 161	TRADD, N-terminal domain	Domain
PF00531	Death	217 → 304	Death domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in all examined tissues. {ECO:0000269|PubMed:7758105}.

Sequence

MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA

Sequence length

312

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
TRADD-related disorder	Uncertain significance	rs201869508, rs892184360	RCV003406143 RCV003911530

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenoma Islet Cell	Associate	26748784
Alzheimer Disease	Associate	39396083
Arthritis Rheumatoid	Stimulate	16951485
Arthritis Rheumatoid	Associate	37904685
Cicatrix Hypertrophic	Inhibit	24962175
Colorectal Neoplasms	Associate	38214751
Coronary Artery Disease	Associate	32710445
Drug Related Side Effects and Adverse Reactions	Associate	12446787
Glioblastoma	Associate	23908590
Glioma	Associate	23908590
Head and Neck Neoplasms	Associate	22170762
Inflammation	Associate	21820422
Lead Poisoning Nervous System	Associate	38146363
Leukemia	Associate	21820422
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	11166462
Leukemia Promyelocytic Acute	Associate	25033841
Lung Neoplasms	Associate	37864090
Neoplasms	Associate	35502302
Prostatic Neoplasms	Associate	19934328
Rectal Neoplasms	Associate	35502302
Stomach Neoplasms	Associate	15991280

TRADD (TNFRSF1A associated via death domain)