Gene Gene information from NCBI Gene database.
Entrez ID 29896
Gene name Transformer 2 alpha homolog
Gene symbol TRA2A
Synonyms (NCBI Gene)
AWMS1HSU53209
Chromosome 7
Chromosome location 7p15.3
Summary This gene is a member of the transformer 2 homolog family and encodes a protein with several RRM (RNA recognition motif) domains. This phosphorylated nuclear protein binds to specific RNA sequences and plays a role in the regulation of pre-mRNA splicing.
miRNA miRNA information provided by mirtarbase database.
216
miRTarBase ID miRNA Experiments Reference
MIRT016048 hsa-miR-374b-5p Sequencing 20371350
MIRT047833 hsa-miR-30c-5p CLASH 23622248
MIRT042676 hsa-miR-196b-5p CLASH 23622248
MIRT1450539 hsa-miR-142-5p CLIP-seq
MIRT1450540 hsa-miR-1468 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IDA 9546399
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602718 16645 ENSG00000164548
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13595
Protein name Transformer-2 protein homolog alpha (TRA-2 alpha) (TRA2-alpha) (Transformer-2 protein homolog A)
Protein function Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 121 191 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIR
VDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
Sequence length 282
Interactions View interactions