Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29896
Gene name Gene Name - the full gene name approved by the HGNC.
Transformer 2 alpha homolog
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRA2A
Synonyms (NCBI Gene) Gene synonyms aliases
AWMS1, HSU53209
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p15.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the transformer 2 homolog family and encodes a protein with several RRM (RNA recognition motif) domains. This phosphorylated nuclear protein binds to specific RNA sequences and plays a role in the regulation of pre-mRNA splicing.
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016048 hsa-miR-374b-5p Sequencing 20371350
MIRT047833 hsa-miR-30c-5p CLASH 23622248
MIRT042676 hsa-miR-196b-5p CLASH 23622248
MIRT1450539 hsa-miR-142-5p CLIP-seq
MIRT1450540 hsa-miR-1468 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IDA 9546399
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IDA 9546399
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602718 16645 ENSG00000164548
Protein
UniProt ID Q13595
Protein name Transformer-2 protein homolog alpha (TRA-2 alpha) (TRA2-alpha) (Transformer-2 protein homolog A)
Protein function Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 121 191 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIR
VDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
Sequence length 282
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Schizophrenia Schizophrenia GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 32372707
Carcinoma Hepatocellular Associate 37564197
Hypoxia Stimulate 35635094
Ovarian Neoplasms Associate 23748175
Pancreatic Neoplasms Associate 35635094
Prostatic Neoplasms Associate 28403887