Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7133
Gene name	TNF receptor superfamily member 1B
Gene symbol	TNFRSF1B
Synonyms (NCBI Gene)	CD120bTBPIITNF-R-IITNF-R75TNFBRTNFR1BTNFR2TNFR80p75p75TNFR
Chromosome	1
Chromosome location	1p36.22
Summary	The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity.

283

Show/Hide all (283)

miRTarBase ID	miRNA	Experiments	Reference
MIRT717194	hsa-miR-96-3p	HITS-CLIP	19536157
MIRT717193	hsa-miR-299-3p	HITS-CLIP	19536157
MIRT717192	hsa-miR-3607-5p	HITS-CLIP	19536157
MIRT717191	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT717190	hsa-miR-6072	HITS-CLIP	19536157
MIRT717189	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT717188	hsa-miR-3909	HITS-CLIP	19536157
MIRT717187	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT439411	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439411	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT129887	hsa-miR-193a-3p	HITS-CLIP	22473208
MIRT129893	hsa-miR-193b-3p	HITS-CLIP	22473208
MIRT129958	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT129959	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT717194	hsa-miR-96-3p	HITS-CLIP	19536157
MIRT717193	hsa-miR-299-3p	HITS-CLIP	19536157
MIRT717192	hsa-miR-3607-5p	HITS-CLIP	19536157
MIRT717191	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT717190	hsa-miR-6072	HITS-CLIP	19536157
MIRT717189	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT717188	hsa-miR-3909	HITS-CLIP	19536157
MIRT717187	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT1443039	hsa-miR-1224-3p	CLIP-seq
MIRT1443040	hsa-miR-1260	CLIP-seq
MIRT1443041	hsa-miR-1260b	CLIP-seq
MIRT1443042	hsa-miR-1280	CLIP-seq
MIRT1443043	hsa-miR-1307	CLIP-seq
MIRT1443044	hsa-miR-150	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT1443048	hsa-miR-3170	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT1443050	hsa-miR-323b-3p	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT1443052	hsa-miR-3663-5p	CLIP-seq
MIRT1443053	hsa-miR-3929	CLIP-seq
MIRT1443054	hsa-miR-4419b	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443056	hsa-miR-4435	CLIP-seq
MIRT1443057	hsa-miR-4478	CLIP-seq
MIRT1443058	hsa-miR-450b-3p	CLIP-seq
MIRT1443059	hsa-miR-4532	CLIP-seq
MIRT1443060	hsa-miR-4638-5p	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT1443062	hsa-miR-4701-5p	CLIP-seq
MIRT1443063	hsa-miR-4713-3p	CLIP-seq
MIRT1443064	hsa-miR-4713-5p	CLIP-seq
MIRT1443065	hsa-miR-4716-5p	CLIP-seq
MIRT1443066	hsa-miR-4731-3p	CLIP-seq
MIRT1443067	hsa-miR-4755-3p	CLIP-seq
MIRT1443068	hsa-miR-4772-3p	CLIP-seq
MIRT1443069	hsa-miR-4781-3p	CLIP-seq
MIRT1443070	hsa-miR-4786-3p	CLIP-seq
MIRT1443071	hsa-miR-4801	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT1443073	hsa-miR-532-3p	CLIP-seq
MIRT1443074	hsa-miR-548s	CLIP-seq
MIRT1443075	hsa-miR-588	CLIP-seq
MIRT1443076	hsa-miR-635	CLIP-seq
MIRT1443077	hsa-miR-638	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq
MIRT1443079	hsa-miR-769-3p	CLIP-seq
MIRT2132600	hsa-miR-103b	CLIP-seq
MIRT2132601	hsa-miR-1178	CLIP-seq
MIRT2132602	hsa-miR-1184	CLIP-seq
MIRT2132603	hsa-miR-1207-3p	CLIP-seq
MIRT2132604	hsa-miR-1207-5p	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT2132605	hsa-miR-125a-3p	CLIP-seq
MIRT1443043	hsa-miR-1307	CLIP-seq
MIRT2132606	hsa-miR-142-3p	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT2132607	hsa-miR-3150a-5p	CLIP-seq
MIRT2132608	hsa-miR-3150b-5p	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT1443052	hsa-miR-3663-5p	CLIP-seq
MIRT2132609	hsa-miR-3665	CLIP-seq
MIRT2132610	hsa-miR-3677-5p	CLIP-seq
MIRT2132611	hsa-miR-371-5p	CLIP-seq
MIRT1443053	hsa-miR-3929	CLIP-seq
MIRT2132612	hsa-miR-3934	CLIP-seq
MIRT2132613	hsa-miR-3944-5p	CLIP-seq
MIRT2132614	hsa-miR-4280	CLIP-seq
MIRT1443054	hsa-miR-4419b	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443056	hsa-miR-4435	CLIP-seq
MIRT1443057	hsa-miR-4478	CLIP-seq
MIRT2132615	hsa-miR-4634	CLIP-seq
MIRT1443060	hsa-miR-4638-5p	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT1443062	hsa-miR-4701-5p	CLIP-seq
MIRT2132616	hsa-miR-4736	CLIP-seq
MIRT1443067	hsa-miR-4755-3p	CLIP-seq
MIRT2132617	hsa-miR-4763-3p	CLIP-seq
MIRT1443068	hsa-miR-4772-3p	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT1443074	hsa-miR-548s	CLIP-seq
MIRT1443075	hsa-miR-588	CLIP-seq
MIRT2132618	hsa-miR-601	CLIP-seq
MIRT2132619	hsa-miR-639	CLIP-seq
MIRT2132620	hsa-miR-640	CLIP-seq
MIRT2132621	hsa-miR-645	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq
MIRT2132622	hsa-miR-764	CLIP-seq
MIRT2132600	hsa-miR-103b	CLIP-seq
MIRT2353571	hsa-miR-106a	CLIP-seq
MIRT2353572	hsa-miR-106b	CLIP-seq
MIRT2132601	hsa-miR-1178	CLIP-seq
MIRT2132602	hsa-miR-1184	CLIP-seq
MIRT2132604	hsa-miR-1207-5p	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT2353573	hsa-miR-1225-3p	CLIP-seq
MIRT2353574	hsa-miR-1343	CLIP-seq
MIRT2132606	hsa-miR-142-3p	CLIP-seq
MIRT1443044	hsa-miR-150	CLIP-seq
MIRT2353575	hsa-miR-17	CLIP-seq
MIRT2353576	hsa-miR-1825	CLIP-seq
MIRT2353577	hsa-miR-1972	CLIP-seq
MIRT2353578	hsa-miR-199a-5p	CLIP-seq
MIRT2353579	hsa-miR-199b-5p	CLIP-seq
MIRT2353580	hsa-miR-20a	CLIP-seq
MIRT2353581	hsa-miR-20b	CLIP-seq
MIRT2353582	hsa-miR-302a	CLIP-seq
MIRT2353583	hsa-miR-302b	CLIP-seq
MIRT2353584	hsa-miR-302c	CLIP-seq
MIRT2353585	hsa-miR-302d	CLIP-seq
MIRT2353586	hsa-miR-302e	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT2353587	hsa-miR-3166	CLIP-seq
MIRT2353588	hsa-miR-3180-5p	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT2353589	hsa-miR-3614-5p	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2132610	hsa-miR-3677-5p	CLIP-seq
MIRT2132611	hsa-miR-371-5p	CLIP-seq
MIRT2353590	hsa-miR-372	CLIP-seq
MIRT2353591	hsa-miR-373	CLIP-seq
MIRT2353592	hsa-miR-378g	CLIP-seq
MIRT2353593	hsa-miR-3925-3p	CLIP-seq
MIRT2132614	hsa-miR-4280	CLIP-seq
MIRT2353594	hsa-miR-4427	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT2353595	hsa-miR-4437	CLIP-seq
MIRT2353596	hsa-miR-4457	CLIP-seq
MIRT1443058	hsa-miR-450b-3p	CLIP-seq
MIRT2132615	hsa-miR-4634	CLIP-seq
MIRT2353597	hsa-miR-4674	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT1443063	hsa-miR-4713-3p	CLIP-seq
MIRT2353598	hsa-miR-4714-3p	CLIP-seq
MIRT2353599	hsa-miR-4717-5p	CLIP-seq
MIRT1443066	hsa-miR-4731-3p	CLIP-seq
MIRT2353600	hsa-miR-4731-5p	CLIP-seq
MIRT2132616	hsa-miR-4736	CLIP-seq
MIRT2353601	hsa-miR-4749-3p	CLIP-seq
MIRT2132617	hsa-miR-4763-3p	CLIP-seq
MIRT1443071	hsa-miR-4801	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT2353602	hsa-miR-512-3p	CLIP-seq
MIRT2353603	hsa-miR-519d	CLIP-seq
MIRT2353604	hsa-miR-520a-3p	CLIP-seq
MIRT2353605	hsa-miR-520b	CLIP-seq
MIRT2353606	hsa-miR-520c-3p	CLIP-seq
MIRT2353607	hsa-miR-520d-3p	CLIP-seq
MIRT2353608	hsa-miR-520e	CLIP-seq
MIRT2353609	hsa-miR-520g	CLIP-seq
MIRT2353610	hsa-miR-520h	CLIP-seq
MIRT1443077	hsa-miR-638	CLIP-seq
MIRT2132619	hsa-miR-639	CLIP-seq
MIRT2353611	hsa-miR-665	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq
MIRT1443079	hsa-miR-769-3p	CLIP-seq
MIRT2353612	hsa-miR-93	CLIP-seq
MIRT2132600	hsa-miR-103b	CLIP-seq
MIRT2132602	hsa-miR-1184	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT1443043	hsa-miR-1307	CLIP-seq
MIRT2396115	hsa-miR-193b	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT2353589	hsa-miR-3614-5p	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2132611	hsa-miR-371-5p	CLIP-seq
MIRT2396116	hsa-miR-4258	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443058	hsa-miR-450b-3p	CLIP-seq
MIRT2396117	hsa-miR-4529-5p	CLIP-seq
MIRT1443060	hsa-miR-4638-5p	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT2396118	hsa-miR-4707-3p	CLIP-seq
MIRT1443063	hsa-miR-4713-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT1443068	hsa-miR-4772-3p	CLIP-seq
MIRT2396120	hsa-miR-4796-3p	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT2353609	hsa-miR-520g	CLIP-seq
MIRT2353610	hsa-miR-520h	CLIP-seq
MIRT1443077	hsa-miR-638	CLIP-seq
MIRT2132619	hsa-miR-639	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq
MIRT1443079	hsa-miR-769-3p	CLIP-seq
MIRT2132604	hsa-miR-1207-5p	CLIP-seq
MIRT2396115	hsa-miR-193b	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT2353589	hsa-miR-3614-5p	CLIP-seq
MIRT2441447	hsa-miR-4260	CLIP-seq
MIRT2441448	hsa-miR-4436b-3p	CLIP-seq
MIRT1443058	hsa-miR-450b-3p	CLIP-seq
MIRT2396117	hsa-miR-4529-5p	CLIP-seq
MIRT1443063	hsa-miR-4713-3p	CLIP-seq
MIRT2132616	hsa-miR-4736	CLIP-seq
MIRT2132617	hsa-miR-4763-3p	CLIP-seq
MIRT2396120	hsa-miR-4796-3p	CLIP-seq
MIRT2353609	hsa-miR-520g	CLIP-seq
MIRT2353610	hsa-miR-520h	CLIP-seq
MIRT1443077	hsa-miR-638	CLIP-seq
MIRT1443079	hsa-miR-769-3p	CLIP-seq
MIRT2462063	hsa-miR-1273f	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT1443048	hsa-miR-3170	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2462064	hsa-miR-3686	CLIP-seq
MIRT2462065	hsa-miR-411	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT2462066	hsa-miR-4446-3p	CLIP-seq
MIRT2462067	hsa-miR-4652-3p	CLIP-seq
MIRT2462068	hsa-miR-4715-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT2462069	hsa-miR-4742-3p	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT2462063	hsa-miR-1273f	CLIP-seq
MIRT1443048	hsa-miR-3170	CLIP-seq
MIRT2462064	hsa-miR-3686	CLIP-seq
MIRT2462065	hsa-miR-411	CLIP-seq
MIRT2462067	hsa-miR-4652-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT2462069	hsa-miR-4742-3p	CLIP-seq
MIRT2647785	hsa-miR-1197	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT2462063	hsa-miR-1273f	CLIP-seq
MIRT2647786	hsa-miR-3135	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443048	hsa-miR-3170	CLIP-seq
MIRT2647787	hsa-miR-3650	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2462064	hsa-miR-3686	CLIP-seq
MIRT2462065	hsa-miR-411	CLIP-seq
MIRT2647788	hsa-miR-4428	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443059	hsa-miR-4532	CLIP-seq
MIRT2462067	hsa-miR-4652-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT2462069	hsa-miR-4742-3p	CLIP-seq
MIRT2647789	hsa-miR-644	CLIP-seq
MIRT2647790	hsa-miR-663b	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT2462063	hsa-miR-1273f	CLIP-seq
MIRT1443043	hsa-miR-1307	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2462064	hsa-miR-3686	CLIP-seq
MIRT2462065	hsa-miR-411	CLIP-seq
MIRT2693702	hsa-miR-4279	CLIP-seq
MIRT2693703	hsa-miR-4297	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443060	hsa-miR-4638-5p	CLIP-seq
MIRT2462067	hsa-miR-4652-3p	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT2462069	hsa-miR-4742-3p	CLIP-seq
MIRT2693704	hsa-miR-532-5p	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
JUN	Activation	9743209

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002718	Process	Regulation of cytokine production involved in immune response	IEA
GO:0002718	Process	Regulation of cytokine production involved in immune response	ISS
GO:0002724	Process	Regulation of T cell cytokine production	IBA
GO:0002724	Process	Regulation of T cell cytokine production	IEA
GO:0002724	Process	Regulation of T cell cytokine production	ISS
GO:0002947	Component	Tumor necrosis factor receptor superfamily complex	TAS	24966471
GO:0003176	Process	Aortic valve development	IEA
GO:0003176	Process	Aortic valve development	ISS
GO:0003177	Process	Pulmonary valve development	IEA
GO:0003177	Process	Pulmonary valve development	ISS
GO:0003332	Process	Negative regulation of extracellular matrix constituent secretion	IEA
GO:0003332	Process	Negative regulation of extracellular matrix constituent secretion	ISS
GO:0005031	Function	Tumor necrosis factor receptor activity	IBA
GO:0005031	Function	Tumor necrosis factor receptor activity	IEA
GO:0005031	Function	Tumor necrosis factor receptor activity	TAS	8702885
GO:0005515	Function	Protein binding	IPI	8069916, 10848577, 11244088, 14743216, 24070898, 25609706, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	24966471
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0031641	Process	Regulation of myelination	IEA
GO:0031641	Process	Regulation of myelination	ISS
GO:0031643	Process	Positive regulation of myelination	IBA
GO:0031643	Process	Positive regulation of myelination	IEA
GO:0031643	Process	Positive regulation of myelination	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	24966471
GO:0035579	Component	Specific granule membrane	TAS
GO:0042129	Process	Regulation of T cell proliferation	IBA
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042129	Process	Regulation of T cell proliferation	ISS
GO:0043120	Function	Tumor necrosis factor binding	IBA
GO:0043120	Function	Tumor necrosis factor binding	IPI	9435233
GO:0045121	Component	Membrane raft	IDA	17010968
GO:0045121	Component	Membrane raft	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IBA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050779	Process	RNA destabilization	IEA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IBA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IMP	22480688
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	22480688
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:0150079	Process	Negative regulation of neuroinflammatory response	IBA
GO:0150079	Process	Negative regulation of neuroinflammatory response	IEA
GO:0150079	Process	Negative regulation of neuroinflammatory response	ISS
GO:0150098	Process	Glial cell-neuron signaling	IEA
GO:0150098	Process	Glial cell-neuron signaling	ISS
GO:1902339	Process	Positive regulation of apoptotic process involved in morphogenesis	IEA
GO:1902339	Process	Positive regulation of apoptotic process involved in morphogenesis	ISS

MIM	HGNC	e!Ensembl
191191	11917	ENSG00000028137

P20333

Protein name

Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis fac

Protein function

Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor media

PDB

1CA9 , 3ALQ , 8HLB , 9CU8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	40 → 75	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	78 → 118	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	120 → 161	TNFR/NGFR cysteine-rich region	Domain

Sequence

MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS

Sequence length

461

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Associated with severe COVID-19 disease	Uncertain significance	rs1061622, rs3397	RCV003399150 RCV003399151
Susceptibility to severe coronavirus disease (COVID-19)	Uncertain significance	rs1061622, rs3397	RCV001354054 RCV001354055
Susceptibility to severe coronavirus disease (COVID-19) due to high plasma levels of TNF, TNFR, and/or TNFR2	Uncertain significance	rs1061622	RCV001836993
Susceptibility to severe coronavirus disease (COVID-19) due to high plasma levels of TNF, TNFR, and/or TNFR3	Uncertain significance	rs3397	RCV001836994

Show/Hide Text Mining Associations (181)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	9326234
Acute cholinergic dysautonomia	Associate	33536237
Adenocarcinoma	Associate	32073741
Adenocarcinoma of Lung	Associate	32073741
Alveolitis Extrinsic Allergic	Associate	15929959, 32305453
Alzheimer Disease	Associate	20110607
Anemia Aplastic	Associate	12100146
Aortic Aneurysm Abdominal	Associate	11854734
Aortic Aneurysm Thoracic	Associate	29158612
Appendiceal Neoplasms	Associate	32357859
Arterial Occlusive Diseases	Stimulate	11854734
Arteriosclerosis	Associate	23249640
Arthritis Juvenile	Associate	29306244, 39954509
Arthritis Rheumatoid	Associate	11212177, 12209506, 12209507, 14872483, 15022314, 16207322, 19370184, 23784528, 24782596, 25436214, 27270893, 27640805, 31338093, 31906244, 31953914, 36012570, 36611799 View all (2 more)
Arthropathy progressive pseudorheumatoid of childhood	Stimulate	19370184
Asthma	Associate	21912093, 32032632, 35681430
Autoimmune Diseases	Associate	29339359
Back Pain	Associate	30075559
Bipolar Disorder	Associate	32093803
Bone Diseases Metabolic	Associate	10893687
Brain Injuries	Stimulate	32167668
Breast Diseases	Inhibit	27881867
Breast Neoplasms	Associate	16984377, 25010932, 25928089, 36865537
Bronchiolitis Obliterans Syndrome	Associate	25828101
Calcinosis	Associate	27211902
Carcinogenesis	Associate	32073741, 35979166
Carcinoma Hepatocellular	Stimulate	16425355, 29425759
Carcinoma Hepatocellular	Associate	36865537
Carcinoma in Situ	Stimulate	16984377
Carcinoma Non Small Cell Lung	Associate	21995493, 30628200
Carcinoma Ovarian Epithelial	Associate	20430728
Carcinoma Pancreatic Ductal	Associate	37589506
Carcinoma Renal Cell	Associate	26992212, 27362805, 34221297, 38537932
Carcinoma Squamous Cell	Stimulate	30414907
Carcinoma Squamous Cell	Associate	36865537
Cardiovascular Diseases	Stimulate	29686027
Cerebral Infarction	Stimulate	33918875
Cognition Disorders	Stimulate	26990631
Colitis Associated Neoplasms	Associate	21994466
Colitis Ulcerative	Associate	24379584
Colonic Neoplasms	Associate	14614330
Colorectal Neoplasms	Associate	21994466, 24379584, 25244921, 28412748, 31877663
Communication Disorders	Associate	19900796
Coronary Artery Disease	Inhibit	23249640
Coronary Disease	Associate	29686027
COVID 19	Associate	33246355, 33833618, 34445140, 35294530
Crohn Disease	Associate	29848778, 33767696
Cryptogenic Organizing Pneumonia	Stimulate	21144722
Cystitis Interstitial	Associate	36045687
Cytokine Release Syndrome	Inhibit	35040554
Death	Associate	29686027
Delirium	Associate	37156856
Depressive Disorder	Stimulate	27991935
Depressive Disorder	Associate	29799484
Depressive Disorder Major	Associate	27138824, 27232630
Diabetes Complications	Associate	28367848
Diabetes Mellitus	Stimulate	28367848
Diabetes Mellitus Type 1	Associate	21584225
Diabetes Mellitus Type 2	Associate	21849023, 28367848
Diabetes Mellitus Type 2	Stimulate	36614270
Diabetic Nephropathies	Associate	26928194, 33122288
Down Syndrome	Associate	27293319
Drug Hypersensitivity	Associate	35681430
Drug Related Side Effects and Adverse Reactions	Associate	11762942, 15899873, 26992212, 7509279, 9685865
Dyskinesia Drug Induced	Associate	34103471
Endocarditis	Stimulate	10931145
Endometrial Neoplasms	Associate	37233761, 38013616
Endometriosis	Inhibit	18061173, 18976764
Endometriosis	Associate	24844917, 38013616
Epilepsy Temporal Lobe	Associate	27006531
Esophageal Squamous Cell Carcinoma	Associate	20646319
Exocrine Pancreatic Insufficiency	Associate	35130326
Fabry Disease	Inhibit	40420032
Fallopian Tube Diseases	Associate	12496205
Fatigue	Associate	23852407
Glioma	Associate	31649684, 34798125
Granulomatous Disease Chronic	Associate	14688376
Heart Diseases	Associate	30734494
Heart Failure	Associate	22790687, 22921902
Heart Failure	Stimulate	28367848
Hepatitis Alcoholic	Associate	29425759
Hepatitis B Chronic	Associate	29915336
HIV Infections	Associate	11861282
Hodgkin Disease	Associate	31877663
Hyperaldosteronism	Associate	33316770
Hyperandrogenism	Associate	12161545
Hypoxia	Inhibit	19473970
Hypoxia	Associate	36244759
Idiopathic Pulmonary Fibrosis	Associate	15809201
IgA Vasculitis	Associate	10102645
Infections	Associate	38088554
Inflammation	Associate	16280439, 18536177, 20066156, 21508170, 21584225, 21912093, 22701743, 22921902, 23968978, 26515035, 26896068, 27637172, 29800615, 31519862, 31810488 View all (10 more)
Inflammation	Inhibit	38382266
Inflammatory Bowel Diseases	Associate	21994466
Insulin Resistance	Associate	23651848
Ischemia	Stimulate	19473970
Keratoconus	Associate	16275928
Kidney Diseases	Associate	26928194, 34045516
Leukemia	Associate	33027529, 37554265
Leukemia Lymphocytic Chronic B Cell	Associate	1384790
Leukemia Lymphoma Adult T Cell	Associate	32196559
Leukemia Myeloid Acute	Associate	1382704, 29922294
Leukemia Myeloid Acute	Stimulate	24757092
Leukemia Promyelocytic Acute	Associate	12893766
Leukemic Infiltration	Associate	27519317
Lichen Planus	Associate	9188868
Lichen Planus Oral	Associate	30329194
Liver Diseases	Associate	16425355, 29915336
Liver Failure	Associate	29915336
Lung Diseases	Associate	33246355
Lung Diseases Interstitial	Associate	21144722
Lung Neoplasms	Associate	26280204, 30989732
Lupus Erythematosus Systemic	Associate	11762942
Lymphatic Metastasis	Associate	26280204
Lymphoma	Associate	29504848
Lymphoma Follicular	Associate	16763612
Lymphoma Non Hodgkin	Associate	21063024, 23814017, 37809067
Lymphoma T Cell Cutaneous	Associate	35787399
Melanoma	Inhibit	10353757
Melanoma	Associate	24778320, 31924735, 35879777, 36865537, 8305739
Mitochondrial Diseases	Associate	31953914
Mouth Diseases	Associate	18976764
Multiple Myeloma	Associate	21850048, 31877663
Multiple Sclerosis	Associate	37903821
Mycosis Fungoides	Associate	26258847, 26918607
Myotonic Dystrophy	Stimulate	15217754
Necrosis	Associate	15461705
Neoplasm Metastasis	Associate	25010932, 26280204, 31877663
Neoplasms	Inhibit	16189158
Neoplasms	Stimulate	16984377, 20430728
Neoplasms	Associate	20646319, 21995493, 25010932, 26113409, 26280204, 29339359, 30356161, 30628200, 31877663, 32357859, 33326414, 34766338, 36865537, 37589506, 9685865
Neuroblastoma	Associate	21419569, 7777541
Neuroma	Associate	39362479
Non alcoholic Fatty Liver Disease	Associate	23935829
Obesity	Stimulate	16784178
Obesity	Associate	18685868
Osteoarthritis	Stimulate	9682783
Osteoporosis	Associate	17002564
Ovarian Neoplasms	Associate	19263582, 31877663
Pancreatic Neoplasms	Associate	35048633, 37589506
Paranoid Disorders	Associate	30254506
Pemphigus	Associate	32926429
Peripheral Nervous System Diseases	Associate	20818983
Peritonitis	Associate	8807591
Photosensitivity Disorders	Associate	32122970
Pneumonia	Associate	20811626
Polycystic Ovary Syndrome	Associate	12161545
Polyomavirus Infections	Stimulate	36512270
Pre Eclampsia	Inhibit	38382266
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	36901957
Premature Birth	Associate	21627550, 35130326
Prostatic Neoplasms	Associate	33326414, 37108754
Pulmonary Disease Chronic Obstructive	Associate	21912093, 25155252
Pulmonary Disease Chronic Obstructive	Stimulate	28744116
Q Fever	Associate	10931145
Renal Insufficiency	Associate	15461705
Reperfusion Injury	Associate	19473970
Respiratory Tract Infections	Associate	39266570
Retinal Diseases	Associate	25086184
Retinopathy of Prematurity	Inhibit	31266060
Rufous oculocutaneous albinism	Inhibit	16189158
Sarcoidosis	Associate	16889950, 27158798
Schizophrenia	Associate	24743863, 30254506, 32093803, 34103471, 35027554
Schizophrenia	Stimulate	30254506
Schizophrenia Paranoid	Associate	30254506
Scleroderma Systemic	Associate	35674522
Sezary Syndrome	Associate	26258847, 30356161
Sjogren's Syndrome	Associate	27180164, 29504848
Smoldering Multiple Myeloma	Associate	26668134
Spinal Cord Injuries	Stimulate	20818983
Spondylitis Ankylosing	Associate	25061744
Squamous Cell Carcinoma of Head and Neck	Associate	26113409
Stomach Neoplasms	Associate	31659258, 33661721, 34766338, 35979166, 37747314
Stroke	Associate	22167233, 33918875
Thoracic Injuries	Associate	30075559
Triple Negative Breast Neoplasms	Associate	35228654
Tuberculosis	Associate	20007930, 37956380, 38088554
Uterine Cervical Diseases	Associate	35130326
Uterine Cervical Neoplasms	Associate	25113639
Vascular Diseases	Associate	37575057
Weight Loss	Associate	37738560

TNFRSF1B (TNF receptor superfamily member 1B)