Gene Gene information from NCBI Gene database.
Entrez ID 7132
Gene name TNF receptor superfamily member 1A
Gene symbol TNFRSF1A
Synonyms (NCBI Gene)
CD120aFPFTBP1TNF-RTNF-R-ITNF-R55TNFARTNFR1TNFR55TNFR60p55p55-Rp60
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Bindin
SNPs SNP information provided by dbSNP.
26
SNP ID Visualize variation Clinical significance Consequence
rs1800693 T>C Benign, risk-factor, likely-benign Intron variant
rs4149584 C>G,T Conflicting-interpretations-of-pathogenicity, pathogenic Coding sequence variant, 5 prime UTR variant, missense variant, non coding transcript variant
rs34751757 G>A,T Not-provided, conflicting-interpretations-of-pathogenicity Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs104895217 A>G Pathogenic Non coding transcript variant, 5 prime UTR variant, intron variant, coding sequence variant, missense variant
rs104895218 C>T Pathogenic Non coding transcript variant, 5 prime UTR variant, intron variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
127
miRTarBase ID miRNA Experiments Reference
MIRT051697 hsa-let-7e-5p CLASH 23622248
MIRT1443001 hsa-miR-1197 CLIP-seq
MIRT1443002 hsa-miR-1266 CLIP-seq
MIRT1443003 hsa-miR-194 CLIP-seq
MIRT1443004 hsa-miR-1973 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
84
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 22801493
GO:0000139 Component Golgi membrane IEA
GO:0002947 Component Tumor necrosis factor receptor superfamily complex TAS 24966471
GO:0003176 Process Aortic valve development IEA
GO:0003176 Process Aortic valve development ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
191190 11916 ENSG00000067182
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P19438
Protein name Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A,
Protein function Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation whic
PDB 1EXT , 1FT4 , 1ICH , 1NCF , 1TNR , 7K7A , 7KP7 , 7KP8 , 7KPB , 8P6Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 44 81 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 84 125 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 127 166 TNFR/NGFR cysteine-rich region Domain
PF00531 Death 356 441 Death domain Domain
Sequence
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDC
RECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVC
GCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEAL
CGPAALPPAPSLLR
Sequence length 455
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
561
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Autoinflammatory syndrome Likely pathogenic; Pathogenic rs104895271, rs104895238, rs104895252 RCV002262667
RCV002262668
RCV002264542
Behcet disease Pathogenic rs886039866 RCV000258049
CHARGE syndrome Pathogenic rs1592047560 RCV000984328
Multiple sclerosis Pathogenic rs104895219 RCV004798724
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Associated with severe COVID-19 disease Benign rs767455, rs1800693 RCV003401207
RCV003398577
Cervical cancer Benign; Likely benign rs199743143 RCV005890875
Familial Periodic Fever Uncertain significance; Likely benign rs554776242, rs201099296 RCV000368173
RCV000299328
RCV000314440
Febrile seizure (within the age range of 3 months to 6 years) Conflicting classifications of pathogenicity rs104895288 RCV000626739
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 11318938, 16308343, 23461592, 23965844, 36752501, 37470237
Abdominal Pain Associate 11953985, 21978701, 23965844
Abnormalities Drug Induced Associate 10540181
Abortion Habitual Stimulate 36495656
Acquired Immunodeficiency Syndrome Associate 11861282, 9326234
Acute Kidney Injury Associate 34975885
Adenocarcinoma Associate 29985074
Adenocarcinoma of Lung Associate 26313705
Adenoma Associate 23082052
Adenoma Islet Cell Associate 26748784