Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7124
Gene name Gene Name - the full gene name approved by the HGNC.	Tumor necrosis factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNF
Synonyms (NCBI Gene) Gene synonyms aliases	DIF, IMD127, TNF-alpha, TNFA, TNFSF2, TNLG1F
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800629	G>A	Drug-response	Upstream transcript variant
rs281865419	C>T	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006787	hsa-miR-19a-3p	Luciferase reporter assay	21271217
MIRT006857	hsa-miR-203a-3p	Luciferase reporter assay	22917968
MIRT006857	hsa-miR-203a-3p	Luciferase reporter assay	22917968
MIRT053456	hsa-miR-452-5p	Microarray	23807165
MIRT054325	hsa-miR-187-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	23071313
MIRT006787	hsa-miR-19a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23795660
MIRT006787	hsa-miR-19a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23795660
MIRT437418	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR	23804075
MIRT054762	hsa-miR-130a-3p	qRT-PCR, Western blot	26045761
MIRT054762	hsa-miR-130a-3p	ChIP, Luciferase reporter assay, qRT-PCR, Western blot	26435691
MIRT054762	hsa-miR-130a-3p	ChIP, Luciferase reporter assay, qRT-PCR, Western blot	26435691
MIRT736380	hsa-miR-34a-5p	PCR array	28097098
MIRT006787	hsa-miR-19a-3p	Luciferase reporter assay	26041742
MIRT006787	hsa-miR-19a-3p	Luciferase reporter assay	26041742
MIRT732884	hsa-miR-182-5p	qRT-PCR	31990371
MIRT733152	hsa-miR-146a-3p	qRT-PCR, ELISA	33376728
MIRT733305	hsa-miR-23a-5p	RNA-seq	33262617
MIRT733306	hsa-miR-183-5p	RNA-seq	33262617
MIRT733307	hsa-miR-193a-5p	RNA-seq	33262617
MIRT733307	hsa-miR-193a-5p	RNA-seq	33262617
MIRT733309	hsa-miR-941	RNA-seq	33262617
MIRT733677	hsa-miR-100-5p	qRT-PCR, Western blotting	33980036
MIRT735823	hsa-let-7c-5p	qRT-PCR	34198264
MIRT735824	hsa-miR-149-5p	qRT-PCR	34198264
MIRT735944	hsa-miR-155-3p	Microarray, Immunoprecipitaion (IP)	31641696
MIRT736023	hsa-miR-708-5p	Western blotting, qRT-PCR, ELISA	33776573
MIRT736380	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Immunocytochemistry (ICC)	33305319
MIRT737366	hsa-miR-381-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR, Flow cytometry	32411707
MIRT755647	hsa-miR-124-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38146363
MIRT1442045	hsa-miR-130a	CLIP-seq
MIRT1442046	hsa-miR-130b	CLIP-seq
MIRT1442047	hsa-miR-19a	CLIP-seq
MIRT1442048	hsa-miR-19b	CLIP-seq
MIRT1442049	hsa-miR-301a	CLIP-seq
MIRT1442050	hsa-miR-301b	CLIP-seq
MIRT1442051	hsa-miR-34b	CLIP-seq
MIRT1442052	hsa-miR-3666	CLIP-seq
MIRT1442053	hsa-miR-4295	CLIP-seq
MIRT1442054	hsa-miR-4457	CLIP-seq
MIRT1442055	hsa-miR-454	CLIP-seq
MIRT1442056	hsa-miR-4803	CLIP-seq
MIRT1442057	hsa-miR-513b	CLIP-seq
MIRT1442058	hsa-miR-519a	CLIP-seq
MIRT1442059	hsa-miR-519b-3p	CLIP-seq
MIRT1442060	hsa-miR-519c-3p	CLIP-seq
MIRT2132326	hsa-miR-1208	CLIP-seq
MIRT2132327	hsa-miR-1299	CLIP-seq
MIRT2132328	hsa-miR-1972	CLIP-seq
MIRT2132329	hsa-miR-3944-5p	CLIP-seq
MIRT2132330	hsa-miR-4310	CLIP-seq
MIRT2132331	hsa-miR-4420	CLIP-seq
MIRT2132332	hsa-miR-4717-5p	CLIP-seq
MIRT1442056	hsa-miR-4803	CLIP-seq

Transcription factors

Show/Hide all(24)

Transcription factor	Regulation	Reference
ATF2	Activation	10688670;10748079;10913190;20068037
CEBPB	Unknown	10629048;9566900
CEBPD	Unknown	10629048
E2F1	Unknown	17707233
EGR1	Activation	10913190;14767560
ETV4	Unknown	7896795
HDAC11	Repression	21239696
HDAC3	Unknown	15356147
HMGB2	Activation	18218727
HSF1	Unknown	18689673
IRF5	Unknown	20237317
JUN	Activation	10318823;10688670;10748079;10913190
JUN	Unknown	7896795;9566900
LRRFIP1	Repression	16199883
NFAT5	Unknown	11485737
NFKB1	Activation	10079106;10748079;11749970;12058956;12686724;15013838;16707469;16916598;17407192;18057724;20066113;7876168;8219230;8679226
NFKB1	Unknown	10551799;10837498;10963848;11297551;14960579;15812247;16040075;16433741;17442180;17707233;18285351;20237317;9916895
NR4A1	Repression	19213954
RELA	Activation	10079106;10748079;11749970;12058956;12686724;15013838;16707469;16916598;17407192;18057724;20066113;7876168;8219230;8679226
RELA	Unknown	10551799;10837498;10963848;11297551;14960579;15812247;16040075;16433741;17442180;17707233;18285351;20237317;9916895
SIRT1	Unknown	21245135
SP1	Activation	10688670;10913190
SP1	Repression	12759366
SPI1	Unknown	10748079

Show/Hide all(317)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	1618860
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15345745
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17350185
GO:0001666	Process	Response to hypoxia	IEA
GO:0001774	Process	Microglial cell activation	IEA
GO:0001774	Process	Microglial cell activation	ISS
GO:0001774	Process	Microglial cell activation	NAS	26753638
GO:0001819	Process	Positive regulation of cytokine production	IDA	10443688, 17922812
GO:0001891	Component	Phagocytic cup	IEA
GO:0001891	Component	Phagocytic cup	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	17389591
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	12777399
GO:0002037	Process	Negative regulation of L-glutamate import across plasma membrane	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002439	Process	Chronic inflammatory response to antigenic stimulus	IMP	14512626
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IDA	10443688
GO:0002876	Process	Positive regulation of chronic inflammatory response to antigenic stimulus	IEA
GO:0002925	Process	Positive regulation of humoral immune response mediated by circulating immunoglobulin	IEA
GO:0003009	Process	Skeletal muscle contraction	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	10748004, 27830702
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	24966471
GO:0005164	Function	Tumor necrosis factor receptor binding	IDA	14512626
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IPI	9435233
GO:0005515	Function	Protein binding	IPI	2848815, 11878931, 12887920, 14743216, 17681535, 19838188, 20080539, 20103630, 21784977, 22028622, 23032186, 23104095, 23955153, 24070898, 25241761, 25911380, 26649818, 30561431, 32296183, 32814053, 33961781, 36179048, 36555597
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	24966471
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	23552949, 27830702
GO:0005615	Component	Extracellular space	IDA	3932069, 10443688, 12594207, 18355445, 21323571
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IDA	18355445
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IDA	10748004, 21147091, 22267480
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	IEA
GO:0007254	Process	JNK cascade	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	ISS
GO:0007623	Process	Circadian rhythm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IBA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	10521396, 18202225, 18676776
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	NAS	21319131
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009615	Process	Response to virus	IDA	10490959
GO:0009617	Process	Response to bacterium	IEA
GO:0009651	Process	Response to salt stress	TAS	18355445
GO:0009750	Process	Response to fructose	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009897	Component	External side of plasma membrane	ISS
GO:0009986	Component	Cell surface	IDA	18355445
GO:0010459	Process	Negative regulation of heart rate	IEA
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0010628	Process	Positive regulation of gene expression	IDA	25327529, 28159925, 31824476
GO:0010628	Process	Positive regulation of gene expression	IDA	23608026, 31824476
GO:0010628	Process	Positive regulation of gene expression	IDA	11085990, 21559518, 22267480, 22952837, 23817958, 24998411, 26371161, 31124343
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	24299952
GO:0010628	Process	Positive regulation of gene expression	IMP	16203728, 23892569
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IDA	22499991
GO:0010629	Process	Negative regulation of gene expression	IDA	20164187, 31124343, 31824476
GO:0010629	Process	Negative regulation of gene expression	IDA	15345745, 22267480, 26371161
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IGI	24299952
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	19032770
GO:0010888	Process	Negative regulation of lipid storage	NAS	16464856
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	24966471
GO:0019222	Process	Regulation of metabolic process	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	12813029
GO:0031349	Process	Positive regulation of defense response	IEA
GO:0031622	Process	Positive regulation of fever generation	IEA
GO:0031622	Process	Positive regulation of fever generation	ISS
GO:0031642	Process	Negative regulation of myelination	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	10443688
GO:0032722	Process	Positive regulation of chemokine production	IDA	10490959
GO:0032724	Process	Positive regulation of fractalkine production	IEA
GO:0032724	Process	Positive regulation of fractalkine production	ISS
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	31124343
GO:0032741	Process	Positive regulation of interleukin-18 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	24299952
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	23608026, 31824476
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	20551324
GO:0032757	Process	Positive regulation of interleukin-8 production	IGI	23608026
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	24790089
GO:0032991	Component	Protein-containing complex	TAS	24966471
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IBA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	7758105, 11907583
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	10443688, 12813029, 15310755, 28159925, 31824476
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEP	12761501
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	10748004
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	NAS	23878390
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	24966471
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	24966471
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	10604883, 20551324
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IEA
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IEA
GO:0034250	Process	Positive regulation of amide metabolic process	IEA
GO:0035900	Process	Response to isolation stress	IEA
GO:0036005	Process	Response to macrophage colony-stimulating factor	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	8565075
GO:0038177	Function	Death receptor agonist activity	IDA	10748004
GO:0038177	Function	Death receptor agonist activity	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042802	Function	Identical protein binding	IDA	14512626
GO:0042802	Function	Identical protein binding	IPI	2922050, 19838188, 23815148
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16723520, 17389591, 22173242
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	9343261
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043068	Process	Positive regulation of programmed cell death	IDA	16611992
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IDA	10748004
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	11374864, 15310755, 17922812, 20551324
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	15121867
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	18201371
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	NAS	23878390
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	TAS	18309324
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	TAS	29702085
GO:0043242	Process	Negative regulation of protein-containing complex disassembly	IDA	17389591
GO:0043243	Process	Positive regulation of protein-containing complex disassembly	IDA	12813029, 17389591
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	17389591
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10748004, 15310755
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	12813029, 18440775
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	17389591
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	22499991
GO:0045071	Process	Negative regulation of viral genome replication	IDA	10490959
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IDA	17010968
GO:0045121	Component	Membrane raft	IEA
GO:0045123	Process	Cellular extravasation	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	8383325
GO:0045471	Process	Response to ethanol	IEA
GO:0045598	Process	Regulation of fat cell differentiation	ISS
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	NAS	16464856
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	18632959
GO:0045760	Process	Positive regulation of action potential	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IMP	23892569
GO:0045834	Process	Positive regulation of lipid metabolic process	IEA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16895791, 17350185
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10748004, 14512626, 17350185
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15345745, 20551324
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	16803872
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045994	Process	Positive regulation of translational initiation by iron	IEA
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	17389591
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0048143	Process	Astrocyte activation	NAS	26753638
GO:0048566	Process	Embryonic digestive tract development	IEP	20875417
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	16518841
GO:0050708	Process	Regulation of protein secretion	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	TAS	24966471
GO:0050768	Process	Negative regulation of neurogenesis	TAS	20018408
GO:0050793	Process	Regulation of developmental process	IEA
GO:0050796	Process	Regulation of insulin secretion	IDA	8383325
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0050806	Process	Positive regulation of synaptic transmission	ISS
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0050807	Process	Regulation of synapse organization	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050890	Process	Cognition	TAS	22277195
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	IEA
GO:0050901	Process	Leukocyte tethering or rolling	IDA	10820279
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IDA	19032770
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	18373975
GO:0051046	Process	Regulation of secretion	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	15790681
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	16280327, 16611992, 25193116
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	24790089
GO:0051222	Process	Positive regulation of protein transport	IDA	15310755
GO:0051222	Process	Positive regulation of protein transport	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051384	Process	Response to glucocorticoid	IDA	10443688
GO:0051798	Process	Positive regulation of hair follicle development	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	TAS	22277195
GO:0055037	Component	Recycling endosome	IEA
GO:0055037	Component	Recycling endosome	ISS
GO:0060252	Process	Positive regulation of glial cell proliferation	IDA	2104886
GO:0060252	Process	Positive regulation of glial cell proliferation	IGI	1752215
GO:0060557	Process	Positive regulation of vitamin D biosynthetic process	IDA	1690216
GO:0060664	Process	Epithelial cell proliferation involved in salivary gland morphogenesis	IEA
GO:0060693	Process	Regulation of branching involved in salivary gland morphogenesis	IEA
GO:0061044	Process	Negative regulation of vascular wound healing	IDA	22499991
GO:0061048	Process	Negative regulation of branching involved in lung morphogenesis	IDA	17350185
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	NAS	18606301
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IDA	16803872
GO:0071219	Process	Cellular response to molecule of bacterial origin	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071316	Process	Cellular response to nicotine	IDA	18676776
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IDA	22836756
GO:0071677	Process	Positive regulation of mononuclear cell migration	NAS	21319131
GO:0071803	Process	Positive regulation of podosome assembly	IDA	15220135
GO:0072577	Process	Endothelial cell apoptotic process	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	25816133
GO:0090324	Process	Negative regulation of oxidative phosphorylation	IEA
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0090594	Process	Inflammatory response to wounding	IEA
GO:0097190	Process	Apoptotic signaling pathway	IDA	8565075
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	11577081, 16611992
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:0097421	Process	Liver regeneration	IEA
GO:0097527	Process	Necroptotic signaling pathway	IDA	11101870, 22265413, 22265414, 22817896
GO:0097527	Process	Necroptotic signaling pathway	IEA
GO:0120190	Process	Negative regulation of bile acid secretion	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	11773383
GO:0140460	Process	Response to Gram-negative bacterium	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	22277195, 26753638
GO:0150129	Process	Positive regulation of interleukin-33 production	IDA	31824476
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	31824476
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IGI	23608026
GO:1900222	Process	Negative regulation of amyloid-beta clearance	IEA
GO:1900222	Process	Negative regulation of amyloid-beta clearance	ISS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	31124343
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	10383454, 17922812, 20041225
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901647	Process	Positive regulation of synoviocyte proliferation	IDA	31124343
GO:1902004	Process	Positive regulation of amyloid-beta formation	IEA
GO:1902004	Process	Positive regulation of amyloid-beta formation	ISS
GO:1902065	Process	Response to L-glutamate	IEA
GO:1902565	Process	Positive regulation of neutrophil activation	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	NAS	23878390
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	22499991
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	ISS
GO:1903140	Process	Regulation of establishment of endothelial barrier	IDA	25816133
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IDA	25816133
GO:1903829	Process	Positive regulation of protein localization	IEA
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IDA	26371161
GO:1904999	Process	Positive regulation of leukocyte adhesion to arterial endothelial cell	IDA	22267480
GO:1905038	Process	Regulation of membrane lipid metabolic process	IEA
GO:1905242	Process	Response to 3,3',5-triiodo-L-thyronine	IEA
GO:1990268	Process	Response to gold nanoparticle	IEA
GO:2000010	Process	Positive regulation of protein localization to cell surface	IDA	19366699
GO:2000334	Process	Positive regulation of blood microparticle formation	IDA	24998411
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IDA	20551324
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000351	Process	Regulation of endothelial cell apoptotic process	IMP	10843670
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IDA	22836756
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IGI	31124343
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	10666185, 10748004

MIM	HGNC	e!Ensembl
191160	11892	ENSG00000232810

Protein

UniProt ID

P01375

Protein name

Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-doma

Protein function

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretio

PDB

1A8M , 1TNF , 2AZ5 , 2E7A , 2TUN , 2ZJC , 2ZPX , 3ALQ , 3IT8 , 3L9J , 3WD5 , 4G3Y , 4TSV , 4TWT , 4Y6O , 5M2I , 5M2J , 5M2M , 5MU8 , 5TSW , 5UUI , 5WUX , 5YOY , 6OOY , 6OOZ , 6OP0 , 6RMJ , 6X81 , 6X82 , 6X83 , 6X85 , 6X86 , 7ASY , 7AT7 , 7ATB , 7JRA , 7KP9 , 7KPA , 7KPB , 7QLF , 7TA3 , 7TA6 , 8Z8M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00229	TNF	102 → 233	TNF(Tumour Necrosis Factor) family	Domain

Sequence

MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Sequence length

233

Interactions

View interactions

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer disease, protection against	N/A	N/A	ClinVar
Asthma	Asthma (childhood onset)	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Endometriosis	endometriosis	N/A	N/A	ClinVar
Hypertension	Hypertension	N/A	N/A	GWAS
Hyperthyroidism	Hyperthyroidism	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1818)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3C syndrome	Associate	19753481
Abdominal Pain	Associate	31707933
Abnormalities Drug Induced	Associate	10540181, 29664552
Abnormalities Drug Induced	Stimulate	12032170
Abortion Habitual	Associate	18394614, 29017513
Abortion Habitual	Stimulate	36495656, 36631028, 9093132
Abortion Missed	Associate	28851386
Abortion Spontaneous	Associate	11737072, 23202728, 35392343, 35955896
Abortion Spontaneous	Stimulate	17482605, 33731680
Abortion Spontaneous	Inhibit	21977049, 36096448
Abscess	Associate	37091905
Accessory Nerve Injuries	Associate	35892263
Acidemia isovaleric	Associate	25510775
Acidosis	Associate	11918735
Acquired Immunodeficiency Syndrome	Associate	15327898, 19654554, 20507572, 24587567, 2789293, 32532356, 40450975, 7511077, 8570619, 8815158, 8892857, 9239408, 9665966
Acquired Immunodeficiency Syndrome	Stimulate	1707692, 26475133, 8025276
Acute Chest Syndrome	Associate	26686970
Acute cholinergic dysautonomia	Inhibit	33679766
Acute Coronary Syndrome	Associate	16024973
Acute Coronary Syndrome	Stimulate	25591771, 39399429
Acute Disease	Associate	10572111, 19079204, 26559268
Acute erythroleukemia	Associate	9593784
Acute Generalized Exanthematous Pustulosis	Associate	19657917
Acute Kidney Injury	Associate	15461705, 23607333, 23796916, 24059882, 27788614
Acute Kidney Injury	Stimulate	29238179, 37307405
Acute Lung Injury	Associate	16183668, 18486623, 18948845, 21126389, 27001655, 32720541, 33757467
Acute Lung Injury	Stimulate	33217242, 36835507
Acute On Chronic Liver Failure	Associate	17177978, 31628069
Acute On Chronic Liver Failure	Inhibit	24727541
Adams Stokes Syndrome	Associate	14641910
Adenocarcinoma	Associate	2123888, 23796916, 29985074, 7592709
Adenocarcinoma	Inhibit	36790524
Adenocarcinoma Bronchiolo Alveolar	Associate	29083412
Adenocarcinoma Mucinous	Associate	26017781
Adenocarcinoma of Lung	Associate	11891209, 15528190, 29207489, 30606988, 32945503, 35287670, 35806134, 35864953, 36193315
Adenocarcinoma of Lung	Stimulate	31540489
Adenoma	Stimulate	17160410
Adenoma	Associate	23082052
Adenomyosis	Associate	23706331, 34010983
Adenoviridae Infections	Associate	33270503
Adrenal Gland Neoplasms	Associate	33316770
adult multisystem inflammatory disease COVID 19 related	Inhibit	36102684
Aggressive Periodontitis	Associate	15627647, 17823082, 18587204, 29449347
Agranulocytosis	Associate	7620171, 9166860
Aicardi Goutieres syndrome	Associate	23408864
AIDS Associated Nephropathy	Associate	24896147, 27811066, 31936167, 9507203
AIDS Dementia Complex	Associate	15965202, 18631256, 24625401, 7739519, 8784788
AIDS Dementia Complex	Stimulate	21298033
AIDS Related Complex	Associate	1735193
Airway Obstruction	Associate	28233393
Airway Obstruction	Stimulate	29933531
Akinetic Mutism	Associate	25542735
Alcoholism	Associate	21176217
Alcoholism	Stimulate	26781212, 31541874
Allan Herndon Dudley syndrome	Stimulate	24768357
Allergic Fungal Sinusitis	Associate	24204766, 28859701, 30040868, 31495191
Allergic Fungal Sinusitis	Stimulate	25624129
Alopecia Areata	Associate	20546884, 33370782, 7930677
alpha 1 Antitrypsin Deficiency	Associate	18620570, 26620975
Alveolitis Extrinsic Allergic	Associate	32305453, 34629327
Alzheimer Disease	Associate	18186919, 18715507, 18769539, 19531281, 20110607, 21509504, 21845541, 21891866, 21942811, 22509108, 22832605, 24359497, 28943632, 31175839, 31353852 View all (9 more)
Alzheimer Disease	Stimulate	19767111, 21298033, 29361890, 32114455, 35689551, 37679689, 9013604
Amenorrhea	Associate	20065129
Amyloidosis	Associate	14613268, 22593232
Amyloidosis Hereditary Transthyretin Related	Stimulate	31253122
Amyotrophic Lateral Sclerosis	Associate	26198021, 26212797, 27814735, 35853630
Amyotrophic Lateral Sclerosis	Stimulate	29246232, 32123048
Amyotrophic lateral sclerosis 1	Associate	21062492
Amyotrophic Lateral Sclerosis 2 Juvenile	Associate	18422522
Anal Gland Neoplasms	Associate	28785150
Androgen Insensitivity Syndrome	Stimulate	23904164, 25860946
Anemia	Stimulate	14613268, 18547996, 2066357, 31814801
Anemia	Associate	1824252, 20460119, 21859849, 24286116, 26572590, 30546074
Anemia Aplastic	Stimulate	11754394, 3134066
Anemia Aplastic	Associate	11843845, 12100146, 15345281, 1586705, 17373677, 18477039, 19109204, 21506940, 34220798, 36334505
Anemia Diamond Blackfan	Associate	12750172
Anemia Hemolytic	Associate	23451225
Anemia Hemolytic Autoimmune	Inhibit	38022547
Anemia hereditary spherocytic hemolytic	Associate	27488379
Anemia Iron Deficiency	Associate	18716131
Anemia Sickle Cell	Associate	10641497, 11001897, 11553004, 14965870, 21173096, 21802960, 24290434, 24391023, 25596272, 26686970, 34956203, 7691241
Anemia Sickle Cell	Stimulate	12152923, 23192499, 23922670
Anemia Sickle Cell	Inhibit	23720018
Aneuploidy	Associate	27592797
Aneurysm	Associate	32721809, 35909487
Aneurysm Ascending Aorta	Inhibit	31363123
Aneurysm Ascending Aorta	Associate	34202072, 37207221
Angina Stable	Stimulate	12775581, 35942210
Angina Stable	Associate	28407320
Angina Unstable	Associate	12775581
Angina Unstable	Stimulate	20467748
Angioedemas Hereditary	Inhibit	24611904
Angioedemas Hereditary	Stimulate	26654922, 36142237
Angioedemas Hereditary	Associate	34778454
Anhedonia	Associate	34502316
Ankle Fractures	Stimulate	29940605, 30237391
Anodontia	Stimulate	14982858, 28578351, 39778225
Anodontia	Associate	19623212, 37894839
Anorexia	Associate	17674351
Anorexia	Inhibit	20012999
Anthracosis	Associate	8973625
Anthropophobia	Associate	33936110
Anti N Methyl D Aspartate Receptor Encephalitis	Associate	32771066, 34220828
Anti N Methyl D Aspartate Receptor Encephalitis	Stimulate	36544777
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	15762890, 31249574
Antiphospholipid Syndrome	Associate	19423430
Antiphospholipid Syndrome	Stimulate	37914735
Antisynthetase syndrome	Associate	34905301
Anxiety	Associate	25249351
Aortic Aneurysm	Associate	17478756
Aortic Aneurysm Abdominal	Associate	15288631, 17321344, 22694979, 24853957, 30686933, 32138469
Aortic Aneurysm Abdominal	Stimulate	31885770, 35602104
Aortic Aneurysm Familial Abdominal 1	Associate	25809685, 38287362
Aortic Aneurysm Thoracic	Associate	37445606
Aortic Dissection	Associate	18439917
Aortic Valve Stenosis	Associate	29653899
Aphasia	Inhibit	35259429
Aphasia Primary Progressive	Stimulate	23543794
Apnea	Stimulate	26982450
Apraxias	Associate	29361849
Arachnoid Cysts	Associate	31743616
Arterial Occlusive Diseases	Stimulate	14965870
Arthritis	Associate	11212159, 11830425, 12209522, 12483736, 12823857, 16142749, 16846531, 17503796, 18346273, 1914237, 19587341, 21161742, 21305533, 21787418, 22076945 View all (13 more)
Arthritis	Stimulate	17393419, 31260948
Arthritis Gouty	Stimulate	27169898
Arthritis Gouty	Associate	36994890, 39259129
Arthritis Infectious	Inhibit	18945879, 7858264
Arthritis Infectious	Stimulate	39712015, 8544415
Arthritis Juvenile	Associate	10616003, 12483736, 15728381, 16788246, 17324969, 20191493, 24470328, 24967817, 26934060, 27849614, 29306244, 31941549, 31958219, 36793127, 38460895
Arthritis Psoriatic	Associate	10857783, 11830425, 12368213, 12746914, 15482477, 16409917, 16831294, 17530646, 17828345, 19895991, 20102624, 21954344, 22127698, 22402441, 23527726 View all (27 more)
Arthritis Psoriatic	Stimulate	11851889, 12639988, 16728461, 16741508, 1702929, 19661441, 23144698, 24676037, 37893484
Arthritis Psoriatic	Inhibit	37367825
Arthritis Reactive	Associate	10524675
Arthritis Reactive	Stimulate	16107515
Arthritis Rheumatoid	Associate	10088765, 10204847, 10446857, 10616000, 10616020, 10643698, 10759759, 10765919, 10817565, 10857796, 11056676, 11181651, 11212177, 11219391, 11229456 View all (319 more)
Arthritis Rheumatoid	Stimulate	10749583, 11219394, 11966774, 14613268, 15022319, 15972956, 16684368, 16901957, 16951485, 17032244, 1914237, 22736176, 23024462, 23517397, 24351865 View all (22 more)
Arthritis Rheumatoid	Inhibit	11083259, 12296865, 15140777, 17599736, 18584044, 20444755, 26406605, 29536646, 30106091, 33098857, 38187379
Arthrogryposis and ectodermal dysplasia	Associate	38245732
Arthropathy progressive pseudorheumatoid of childhood	Stimulate	19370184
Ascites	Associate	12801966, 17094388, 34887625
Ascites	Inhibit	28410380
Ascites	Stimulate	28513532
Asthenozoospermia	Stimulate	18287793, 30222022
Asthma	Associate	10227402, 10456966, 11704539, 15976383, 16166100, 16204594, 16456144, 16481637, 16788246, 17322278, 17450233, 17631613, 18088017, 18635892, 18947013 View all (35 more)
Asthma	Stimulate	17947510, 18774390, 19465513, 24500711, 24641294, 25624129, 26546898, 34112152, 35572500, 7512004, 7545095
Asthma	Inhibit	18780949, 19842845, 31676759, 34331994
Astrocytoma	Associate	10501211, 12767055, 17121800, 19850087, 22818222, 40565357
Astrocytoma	Stimulate	9371571
Ataxia Telangiectasia	Associate	25748550, 40607400
Atelosteogenesis type 2	Associate	18094730
Atherosclerosis	Associate	10551885, 11353829, 11728452, 12869027, 12876306, 15358608, 15914954, 16973825, 17066518, 17347550, 17994109, 18270431, 19189937, 19645041, 19652376 View all (31 more)
Atherosclerosis	Stimulate	24098801, 27764724, 28045034, 28672844, 30462552, 32440094
Atrial Fibrillation	Stimulate	19169931, 19569080, 22001292, 29595637
Atrial Fibrillation	Associate	28871102, 36078037
Atrophy	Associate	19351384
Atrophy	Stimulate	37013268, 38004107
Attention Deficit Disorder with Hyperactivity	Inhibit	35197458
Atypical Hemolytic Uremic Syndrome	Associate	26673143
Atypical Squamous Cells of the Cervix	Inhibit	31108390
Aural Atresia Congenital	Associate	37688511
Autism Spectrum Disorder	Associate	21935439, 22226452, 22306264, 29178897, 31591201, 31616420, 32677958, 37108638, 37545517, 38288647
Autism Spectrum Disorder	Stimulate	26418275, 39741321
Autistic Disorder	Stimulate	23437274
Autoimmune Diseases	Associate	11968047, 12568117, 12823857, 15474092, 15728381, 16199883, 1670638, 17234183, 17928893, 18369459, 20096109, 20942939, 21076398, 23703343, 23884763 View all (25 more)
Autoimmune Diseases	Stimulate	20596538
Autoimmune Diseases of the Nervous System	Associate	33287909
Axial osteomalacia	Associate	17828345, 31941549
Axial Spondyloarthritis	Associate	26178906, 34560894
Axial Spondyloarthritis	Stimulate	30029674, 30522483
Bacterial Infections	Associate	10477399, 12801966, 21646350, 23212542, 23940760, 29113587, 34925324, 34956225, 39269158
Bacterial Infections	Inhibit	12853386, 22749533
Bacterial Infections	Stimulate	14987733, 8500890
Barrett Esophagus	Associate	1351861
Basal Ganglia Diseases	Associate	31415412
Basal Ganglia Diseases	Inhibit	37219933
BCG Infection Generalized Familial	Associate	31301515
Behcet Syndrome	Associate	10594567, 12632436, 15196263, 15654837, 15692984, 18685727, 20525258, 21059493, 23336215, 24105615, 25759827, 26222305, 26812624, 27914129, 29854829, 30252881, 39838177, 8712863, 9158087 View all (4 more)
Behcet Syndrome	Stimulate	16891799, 24135410, 24749687, 33957967, 36333776, 39317938
Benign non infected urachal cyst	Associate	37465689
Berylliosis	Stimulate	12449171
Berylliosis	Associate	16980557, 34399367
beta Thalassemia	Associate	19103526, 26376749
Biliary Atresia	Associate	15128911, 40607400
Bipolar Disorder	Stimulate	22832610, 26257203, 31455761
Bipolar Disorder	Inhibit	24143878
Bipolar Disorder	Associate	25172408, 28049760, 34341362, 36303132, 36462601, 37058046
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	35035862
Blau syndrome	Associate	40350497
Blister	Associate	15248227
Blister	Stimulate	18025480, 24462502
Blood Coagulation Disorders	Associate	10393703, 11532095, 17346438, 22493072, 31077224, 31416821, 35180460, 37555786
Blood Loss Surgical	Stimulate	28651907
Blood Platelet Disorders	Associate	15914954, 15956282, 17161243
Blood Platelet Disorders	Stimulate	35180460
Bloom Syndrome	Associate	12619938
Bone Cysts	Associate	31566926
Bone Diseases	Associate	10050719, 12237295, 12396374, 12639988, 18612013, 18978943, 22330139, 24676726, 28137910, 32855274
Bone Diseases	Stimulate	15287939
Bone Diseases Metabolic	Associate	12619938, 36077598
Bone Marrow Diseases	Associate	10572111, 12100146
Bone Marrow Failure Disorders	Associate	12750172, 21659535, 7579440
Bone Resorption	Stimulate	11005785, 9807705
Bone Resorption	Associate	12639988, 15885469, 25278075, 3264773
Boutonneuse Fever	Associate	19386798
Brachydactyly Type D	Stimulate	28504607
Brain Abscess	Associate	17989372
Brain Death	Stimulate	17430397
Brain Diseases	Associate	26661157, 29567026
Brain Diseases	Stimulate	9143252
Brain Edema	Associate	17335802
Brain Infarction	Associate	32503645
Brain Injuries	Stimulate	17881124, 19850087, 9013604
Brain Injuries	Associate	26559268
Brain Injuries Diffuse	Associate	22117975
Brain Injuries Traumatic	Associate	21676422, 21891866, 23768161, 40710309
Brain Injuries Traumatic	Stimulate	23894384, 31173307
Brain Ischemia	Inhibit	30539420
Brain Ischemia	Associate	34199767
Brain Neoplasms	Associate	26017671, 31729458
Breast Diseases	Associate	1320636, 36430763
Breast Diseases	Inhibit	27881867
Breast Neoplasms	Associate	10400831, 10880401, 11751902, 15217507, 15625605, 15999154, 16518599, 16569699, 16785234, 16984377, 1711294, 17234183, 17881900, 18483465, 19052522 View all (111 more)
Breast Neoplasms	Inhibit	14978035, 20177075, 25559835, 8381656, 9109412
Breast Neoplasms	Stimulate	23372803, 29186783, 31552680, 35993650, 37040163
Bronchial Hyperreactivity	Associate	30978295
Bronchiectasis	Stimulate	10515411
Bronchiectasis	Associate	11601743
Bronchiolitis	Associate	31901157, 35620861
Bronchiolitis	Stimulate	36561744
Bronchiolitis Obliterans Syndrome	Associate	18021367, 23607447, 29352737, 33078555, 37965310
Bronchiolitis Obliterans Syndrome	Stimulate	30303525
Bronchitis Chronic	Associate	10706492, 18620570, 26620975
Bronchitis Chronic	Stimulate	9543269
Bronchopulmonary Dysplasia	Associate	37090732
Brucellosis	Associate	10971514
Brucellosis	Stimulate	20404074
Bruton type agammaglobulinemia	Inhibit	17090647
Burkitt Lymphoma	Associate	11313273, 18550789
Burkitt Lymphoma	Stimulate	1281550
Burns	Associate	19060757
Burns	Stimulate	25185059
Bursitis	Inhibit	32270543
Buruli Ulcer	Associate	28241036
Cachexia	Stimulate	10691916, 24119107
Cachexia	Associate	1707692, 2302463, 2695592, 27897403, 27900559, 29802455, 33047901, 34502316, 34787869, 7509363, 7678547, 8632999, 9239408
Calcinosis	Associate	11037898, 19035492, 35808901
Calcinosis	Stimulate	25711438, 29330517, 29653899, 34826571, 39313278
Calcinosis	Inhibit	36780769
Calcinosis Cutis	Associate	26464679, 36371231, 37092550
Cancer Pain	Associate	33000216, 33037017, 35016421
Cap Myopathy	Associate	26799286
Capillary Leak Syndrome	Associate	12149215
Capillary Leak Syndrome	Stimulate	17195014
Carcinogenesis	Associate	11171960, 15722350, 18025480, 18273051, 19124482, 19615068, 22228181, 22355351, 23010174, 23359190, 23866118, 24550071, 24692067, 25826493, 2662193 View all (8 more)
Carcinogenesis	Inhibit	19823053
Carcinogenesis	Stimulate	31911577
Carcinoma	Inhibit	16412062
Carcinoma Basal Cell	Associate	17268792
Carcinoma Basal Cell	Stimulate	31031757
Carcinoma Hepatocellular	Associate	15040026, 15567892, 16419152, 16425355, 16595893, 18030367, 19910749, 20356387, 21545687, 21928250, 22200181, 22354988, 22695741, 22700631, 22911714 View all (43 more)
Carcinoma Hepatocellular	Inhibit	15265907
Carcinoma Hepatocellular	Stimulate	29556041, 33173438, 35125824, 39776121
Carcinoma in Situ	Associate	16984377
Carcinoma Intraductal Noninfiltrating	Associate	21486440
Carcinoma Medullary	Associate	7992839
Carcinoma Non Small Cell Lung	Associate	16757480, 17647268, 18811692, 21995493, 23658645, 24113849, 26472821, 27922077, 28446126, 30659574, 30989732, 33155213, 33158173, 34603277, 35016421, 8097369, 8880099 View all (2 more)
Carcinoma Non Small Cell Lung	Stimulate	19505916, 33125430, 39249157
Carcinoma Non Small Cell Lung	Inhibit	30956278
Carcinoma Ovarian Epithelial	Associate	19484142, 20430728, 32851734, 34071938, 34328090, 8387543
Carcinoma Ovarian Epithelial	Stimulate	28513532
Carcinoma Pancreatic Ductal	Associate	24567526, 30426611, 31381571, 31672677, 33730072, 38018872, 40269781
Carcinoma Renal Cell	Associate	10408703, 10431690, 10944605, 11171960, 12944410, 1596939, 17881124, 19679182, 21068256, 24034344, 24777966, 24885059, 26500094, 26918621, 27297979 View all (11 more)
Carcinoma Renal Cell	Stimulate	18294286, 24768357, 39768130
Carcinoma Renal Cell	Inhibit	9486416
Carcinoma Skin Appendage	Associate	1519669
Carcinoma Small Cell	Stimulate	16412062
Carcinoma Squamous Cell	Associate	10428482, 1503897, 1739610, 19387481, 22450746, 23870134, 24122460, 24550071, 25826493, 28112190, 30414907, 37369480, 37857527
Carcinoma Squamous Cell	Inhibit	20084448
Carcinoma Squamous Cell	Stimulate	22808251
Cardiomyopathies	Associate	10716473, 15218506
Cardiomyopathies	Stimulate	34576032
Cardiomyopathy Dilated	Associate	10850534, 16087131, 16730227, 18654018, 18997986, 25559996, 25827698, 9091515
Cardiomyopathy Dilated	Stimulate	15958363, 34669781
Cardiomyopathy Dilated	Inhibit	29566367
Cardiomyopathy Hypertrophic	Stimulate	24716596
Cardiomyopathy Hypertrophic	Associate	31180540, 35328083
Cardiomyopathy Hypertrophic Familial	Stimulate	35609334
Cardiovascular Diseases	Stimulate	11693755, 27992360
Cardiovascular Diseases	Associate	12006640, 16879221, 20662694, 21795740, 23024462, 25827698, 26751459, 26884864, 27079270, 29316941, 31077224, 32805626, 34667241, 35977003, 36035865, 37782172, 37857527 View all (2 more)
Carotid Artery Diseases	Associate	33376728, 36316672
Carotid Stenosis	Associate	17347550, 21075101, 21393601, 26195278, 27001002, 27017522
Carotid Stenosis	Stimulate	8506944
Cartilage Diseases	Associate	11352237, 15641080, 21352802, 23846219, 24034344, 26045200, 3264773, 36799502
Cartilage Diseases	Stimulate	23257246, 28692119, 33855071, 9536291
Cataract	Associate	29930475
CD59 Deficiency	Stimulate	23058368, 28105709
CD59 Deficiency	Associate	31722123, 33287909, 35955723, 37257547
Celiac Disease	Associate	15608660, 16540751, 18369459, 25915602, 28049849, 29458413, 31591516, 34449925, 35208504, 35371081, 37047806, 38040898
Celiac Disease	Stimulate	35354862
Central Nervous System Diseases	Associate	15327898, 16385659, 30770760, 31395092, 39364412
Central Nervous System Infections	Associate	10100634
Cerebral Arterial Diseases	Associate	13130473, 29567026, 30069915
Cerebral Hemorrhage	Associate	20534169, 31646585, 32129250, 36439158
Cerebral Hemorrhage	Stimulate	38167007
Cerebral Infarction	Inhibit	23286717
Cerebral Infarction	Associate	24817293, 26592822, 31183363, 31192907, 35074627, 36254030
Cerebral Infarction	Stimulate	32805626, 36066144, 38245621
Cerebral Palsy	Associate	22884417, 39729404
Cerebrospinal Fluid Rhinorrhea	Associate	11985531
Cerebrovascular Disorders	Associate	19833626, 24165468
Cerebrovascular Disorders	Stimulate	31744135
Chagas Cardiomyopathy	Associate	16427798, 34867992
Charcot Marie Tooth disease Type 1C	Associate	23319192, 36902479
Cheilitis glandularis	Associate	36814917
Chemical and Drug Induced Liver Injury	Associate	11389006, 26820153, 27175704, 28367089, 28865603, 38050247, 40513998, 9238048
Chemical and Drug Induced Liver Injury	Stimulate	16610058, 22330637
Chemotherapy Related Cognitive Impairment	Associate	27701469
Chills	Associate	14984503
Chlamydia Infections	Associate	35392343, 9038309
Chlamydial Pneumonia	Stimulate	15557648
Chlamydial Pneumonia	Associate	19643200, 9038309
Cholangiocarcinoma	Associate	10209503, 10761710, 12125919, 16565491, 18069763, 19218340, 19721413, 28946560, 31914150, 33737613
Cholangiocarcinoma	Stimulate	25987048
Cholangiocarcinoma	Inhibit	27381730
Cholangitis Sclerosing	Associate	11413121, 11454808, 31626701, 35281002
Cholera	Stimulate	10542136
Cholestasis	Associate	22105759, 35196362
Cholestasis	Stimulate	34971708
Cholestasis Extrahepatic	Associate	32985571
Cholesteatoma	Associate	33627146
Cholesteatoma Middle Ear	Associate	31947538
Chondrosarcoma	Associate	11352241, 12587980
Chordoma	Associate	32011476, 39393273
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Associate	26472821
Chorioamnionitis	Associate	17003486, 17940116, 2005113, 25938217, 35762614
Choristoma	Associate	23553861
Choroidal Effusions	Associate	26367274, 33977746
Choroideremia	Inhibit	20027300
Chromosomal Instability	Stimulate	28651907
Chromosome Aberrations	Stimulate	12149200
Chromosome Deletion	Stimulate	12149200
Chromosome Disorders	Associate	32761646
Chronic Disease	Associate	14519761, 14613268, 1824252, 2056280, 27079270, 28045034, 28505128, 30313113, 30546074, 7790026
Chronic Disease	Stimulate	25630602
Chronic Kidney Disease Mineral and Bone Disorder	Associate	36799882
Chronic Periodontitis	Associate	17823082, 22230463, 23368949, 24363500, 24670840, 25098998, 25530681, 25587209, 26812355, 28341818, 29449347, 30922293
Chronic Periodontitis	Stimulate	26063981, 28341818
Chronic Periodontitis	Inhibit	26211001
Chronic recurrent multifocal osteomyelitis	Stimulate	29565497
Chronic Urticaria	Associate	11918713, 21985375, 36531995, 37646031, 38045687
Churg Strauss Syndrome	Associate	1605306, 17763415
Cicatrix	Associate	17488321, 8245516
Cicatrix	Stimulate	22038912
Ciliary Discoordination Due To Random Ciliary Orientation	Associate	32532356
Ciliary Motility Disorders	Stimulate	29116124
Ciliary Motility Disorders	Associate	38245732
Ciliopathies	Associate	38245732
Citrullinemia	Associate	39512337
Cleft Lip	Associate	1361101, 25360592, 2570526, 8644715
Cleft Palate	Associate	1346481, 1361101, 22174866, 24007308, 7485164, 8554055
Clinical Deterioration	Associate	23975191
Coccidioidomycosis	Associate	12204956
Cockayne Syndrome	Associate	9492179
Cognition Disorders	Associate	22884417, 25542735, 27701469, 27991935, 30256904, 36977552
Cognition Disorders	Stimulate	36195448, 36455873
Cognitive Dysfunction	Stimulate	24332014
Cognitive Dysfunction	Associate	30115946, 31353852, 36159817
Coinfection	Associate	15932510
Colitis	Associate	19794144, 21058909, 21292998, 22187701, 22301110, 23634661, 29922282, 31730855, 35383266, 39991918
Colitis Associated Neoplasms	Associate	22187701, 23688423, 28408791
Colitis Ulcerative	Inhibit	12974765, 22187701
Colitis Ulcerative	Associate	15223609, 17170025, 17300864, 17990358, 18698679, 18942751, 19757042, 20806430, 24705148, 24971461, 25076849, 25346048, 27152519, 27748438, 27895398 View all (27 more)
Colitis Ulcerative	Stimulate	17660846, 18160345, 19309553, 20547854, 21877213, 24197332, 24971461, 26752469, 30369485, 30429108
Colonic Diseases	Associate	10606965, 22434667
Colonic Neoplasms	Associate	11355696, 15611081, 1698444, 17142966, 17394066, 17916596, 19789336, 20307265, 26788912, 27268643, 27273097, 33242241, 37845228, 38287836, 7923248
Colonic Neoplasms	Stimulate	19170965, 36839242
Colonic Neoplasms	Inhibit	9472684
Colonic Polyps	Associate	38297356
Colorectal Neoplasms	Associate	10784420, 11282551, 12657625, 12842827, 14742435, 15188028, 1558785, 16158955, 16937502, 17160410, 17260007, 17300864, 1732118, 18064605, 18433468 View all (61 more)
Colorectal Neoplasms	Stimulate	18433468, 31244280, 37086961
Colorectal Neoplasms	Inhibit	2141333, 25225903
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	29710228
Combined Saposin Deficiency	Associate	24373350
Common Variable Immunodeficiency	Associate	10361243, 11009084, 19076825, 20629103, 31827477, 9508785
Common Variable Immunodeficiency	Stimulate	21548449, 34146579
Common Variable Immunodeficiency	Inhibit	29083052
Communicable Diseases	Associate	10998151, 12823857, 18587204, 19405090, 23579626, 24434549, 30108591, 31409832, 32231389, 32532356, 35373411, 9096369, 9932110
Communicable Diseases	Inhibit	19370184
Communication Disorders	Associate	22194589, 39729404, 9596098
Compassion Fatigue	Stimulate	34390367
Complex Regional Pain Syndromes	Stimulate	17137491, 24462502
Confusion	Associate	40710309
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Associate	32765497
Congenital contractural arachnodactyly	Associate	25422198
Congenital disorder of glycosylation type 1A	Associate	31545495, 33511216
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	22012292, 7636301
Congenital Hyperinsulinism	Stimulate	15837949
Conjunctival Diseases	Associate	19700933
Conjunctivitis Allergic	Associate	30818819
Conversion Disorder	Associate	15218506
Corneal Diseases	Stimulate	1951636
Corneal Endothelial Cell Loss	Stimulate	2466402, 30577658, 31791242, 33060583, 37575057
Corneal Injuries	Associate	12714388
Corneal Perforation	Associate	12714388
Corneal Ulcer	Associate	12714388
Coronary Aneurysm	Associate	32721809
Coronary Artery Disease	Associate	15223716, 15513316, 17346438, 21498926, 22780915, 24736319, 25124382, 25551602, 26751459, 28233393, 28931782, 29131009, 30212581, 30961613, 31287004 View all (13 more)
Coronary Artery Disease	Stimulate	19551157, 21981776, 26749303, 26884864, 30392493, 32805626, 33029103, 38075042
Coronary Disease	Associate	19814730, 24381514, 32957369, 33204729, 33660877, 34850451, 34861059, 35282820, 35866783, 39344313
Coronary Disease	Stimulate	24167372, 27955950, 28390432
Coronary Occlusion	Stimulate	31780868
Coronary Restenosis	Associate	17994109, 21089112
Coronary Restenosis	Stimulate	31729103
Coronary Stenosis	Stimulate	31780868
Coronavirus Infections	Inhibit	28118607
Coronavirus Infections	Associate	33607766, 36876951
Corticosteroid Binding Globulin Deficiency	Associate	30335498, 36139147
Corticosteroid Binding Globulin Deficiency	Stimulate	35578269
Cough	Associate	39465738
COVID 19	Associate	18312678, 32532356, 32673995, 32691695, 32707842, 32783921, 32871183, 32962703, 33078545, 33138195, 33154753, 33190150, 33193384, 33221483, 33228423 View all (79 more)
COVID 19	Stimulate	32217834, 32651212, 32698440, 33006723, 33129099, 33475159, 33947753, 34157151, 34392110, 34436630, 34463916, 34543980, 34576032, 34635175, 34804033 View all (14 more)
COVID 19	Inhibit	34238985, 38179046, 38250080, 39339947
Coxa Magna	Associate	18312678, 25653475, 26045843
Craniosynostoses	Stimulate	36312898
Creutzfeldt Jakob Syndrome	Stimulate	23816234
Critical Illness	Associate	21670923
Crohn Disease	Associate	10075959, 10389698, 10606965, 12105838, 12231473, 12377803, 14656710, 15306588, 15937090, 15958080, 17300864, 17444956, 18025155, 18635600, 18698679 View all (71 more)
Crohn Disease	Stimulate	10719056, 17660846, 18160345, 19309553, 21658307, 22167015, 24918323, 26140540, 26752469, 29182760, 30765731, 31842582, 35665507, 9099934
Crohn Disease	Inhibit	25956706, 31968593, 38517030
Cross Infection	Stimulate	11687457
Cryoglobulinemia Familial Mixed	Stimulate	16142759
Cryopyrin Associated Periodic Syndromes	Associate	12483741, 24773462
Cryopyrin Associated Periodic Syndromes	Stimulate	17320940
Cryptococcosis	Associate	26328591
Cryptogenic Organizing Pneumonia	Stimulate	21144722
Cushing Syndrome	Associate	36316863
Cushing's symphalangism	Associate	14615367
Cystic Disease Of Lung	Associate	15790988, 19144271, 24853301
Cystic Fibrosis	Stimulate	10515411, 22035905, 24098711, 24885494
Cystic Fibrosis	Associate	11337375, 12221127, 12506110, 14525626, 14681029, 15790988, 15963954, 16928707, 17158822, 17210769, 18815075, 19144271, 19201925, 20507572, 20936184 View all (12 more)
Cystitis Interstitial	Associate	24146927, 30973927, 36045687
Cysts	Associate	21755330, 34815804
Cytokine Release Syndrome	Stimulate	10498591, 28696356, 32584515, 33231770, 34359843, 34456907, 37996918, 38097400, 39366520
Cytokine Release Syndrome	Associate	19218687, 39359733
Cytokine Release Syndrome	Inhibit	30713533
Cytomegalovirus Infections	Stimulate	12368210, 22486303, 29527205, 30157919, 32749463, 8113386
Cytomegalovirus Infections	Associate	1331170, 17158960, 22865914, 28501927, 31522446, 31929537, 32532356, 35490594
Death	Associate	11279061, 16427798, 16507998, 23607333, 24165416, 25748550, 26567164, 26768248, 27309850, 28383556, 29802455, 29939989, 31373163, 31681304, 32156252 View all (6 more)
Death	Stimulate	15308849, 24091885, 29361849
deficiency of adenosine deaminase 2	Associate	31015188, 33021335, 36941081, 38115782
Deltaretrovirus Infections	Associate	30466392
Dementia	Associate	10229115, 19531281, 21509504
Dementia Vascular	Associate	36451386
Demyelinating Diseases	Associate	16385659, 16645971, 23319192, 31810488
Dengue	Stimulate	14557666, 25875020, 26421267, 37696512
Dengue	Associate	18272578, 19392621, 25589894, 30315653, 31568656, 34394108
Dental Caries	Associate	21261944, 36507746
Dental Leakage	Associate	37924741
Depressive Disorder	Associate	1309855, 23064081, 24182629, 24598699, 24726621, 29361849, 30310056, 30957546, 32998701, 34787869, 35113419, 36911716, 39760673, 40403713
Depressive Disorder	Stimulate	14973143, 18063307, 22171008, 27991935, 29856741, 37058046
Depressive Disorder Major	Stimulate	17610667, 27138824, 29361849, 29856741, 32919410
Depressive Disorder Major	Associate	24620999, 30310056, 30870525, 34171401, 37058046
Depressive Disorder Treatment Resistant	Stimulate	29103192
Dermatitis	Associate	29143979, 29526761, 7492240
Dermatitis Allergic Contact	Associate	1712219, 27383320
Dermatitis Atopic	Associate	17960185, 22533231, 23328497, 23436698, 24518171, 25315214, 27077833, 29996938, 34070943, 34208434, 36587063, 38302650, 40713851
Dermatitis Atopic	Stimulate	26682905
Dermatitis Contact	Associate	15304089, 37187734
Dermatitis Herpetiformis	Stimulate	16575390
Dermatitis Herpetiformis	Associate	7738367
Dermatitis Toxicodendron	Associate	1712219
Dermatomyositis	Associate	11037898, 12230503, 12485445, 19035492, 20605164, 24127327, 28941496, 35281002
Dermatomyositis	Stimulate	19953283
Developmental Disabilities	Inhibit	19211157
Developmental Dysplasia of the Hip	Associate	25578529
Diabetes Complications	Associate	10540181, 18575614
Diabetes Gestational	Associate	20536548, 26752743, 28112754, 28846666, 31099333, 31940889, 33019392, 36709877, 36849131
Diabetes Gestational	Stimulate	24262292, 26053136, 30020508, 31880859, 32280713, 35390031
Diabetes Gestational	Inhibit	29385062
Diabetes Mellitus	Associate	10829018, 15627647, 16464741, 16864906, 17047287, 17346438, 19769745, 20686866, 20943792, 20967696, 21149504, 21784542, 22012292, 22385239, 25053869 View all (12 more)
Diabetes Mellitus	Stimulate	17911088, 18285554, 18349110, 20377994, 21694775, 24172699, 24521217, 26604209, 27001002, 27123454, 28454543, 30367115, 31244210, 32215181, 34283808, 34951048, 39456722 View all (2 more)
Diabetes Mellitus Type 1	Associate	10540181, 15627647, 16464741, 17174749, 17989340, 18369459, 18575614, 19127455, 19167443, 20686866, 21097392, 23409157, 23494449, 24523574, 25053869 View all (8 more)
Diabetes Mellitus Type 1	Stimulate	12410803, 16864906, 17100770, 19127455, 39273664
Diabetes Mellitus Type 1	Inhibit	15584977
Diabetes Mellitus Type 2	Associate	11469400, 15217754, 15774022, 16784178, 17347550, 17428349, 20007938, 20377994, 20459604, 20967696, 21465273, 21508505, 21709297, 21756351, 22327199 View all (29 more)
Diabetes Mellitus Type 2	Stimulate	17714581, 19633828, 20019678, 23423575, 24429578, 27218216, 27771154, 27904654, 29025405, 29233142, 30212581, 31269743, 34763485, 34917685, 35605453 View all (4 more)
Diabetes Mellitus Type 2	Inhibit	25959254, 28122717, 33446687
Diabetic Cardiomyopathies	Associate	34926700
Diabetic Foot	Stimulate	33096729, 34293021
Diabetic Foot	Associate	35394091
Diabetic Ketoacidosis	Associate	17335802
Diabetic Nephropathies	Associate	15600254, 18575614, 26045828, 28060893, 32684830, 36363561, 40312440, 9067916
Diabetic Nephropathies	Stimulate	26045828, 32684830
Diabetic Neuropathies	Associate	37197158
Diabetic Retinopathy	Associate	25073020, 25617622, 26710229, 33156339, 33396676, 35590353, 38194422, 38222451, 8814750
Diabetic Retinopathy	Stimulate	36465606
Diarrhea	Associate	16760259, 20348510
Diarrhea	Stimulate	35398299
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	37895018
Diffuse Neurofibrillary Tangles with Calcification	Associate	18186919
Diffuse panbronchiolitis	Associate	8915693
Disease	Associate	10219772, 11531944, 11982596, 14977779, 18575614, 19261809, 23326309, 23745338, 2662193, 28646884, 31809599, 37175481, 38051374, 40084286
Disease	Stimulate	15644122, 40065254
Disease Progression	Associate	29172674
Disorders of Excessive Somnolence	Associate	20846669
Disseminated Intravascular Coagulation	Associate	18088351, 40513998, 8182139
Distal myopathy Nonaka type	Associate	11159171, 23496965
Diverticulum	Associate	22187701
Dizziness	Associate	31238711
Down Syndrome	Associate	29093484, 30902060, 36577365
Down Syndrome	Stimulate	31699819
Drug Eruptions	Stimulate	29143979
Drug Eruptions	Associate	34157151
Drug Hypersensitivity	Stimulate	15024131, 18782262, 29054675
Drug Hypersensitivity	Associate	15299030, 18709160, 19657353, 19700933, 2056280, 27383320, 29142473, 32170921, 32476816, 32739252, 35456412, 7529260, 7691450
Drug Hypersensitivity Syndrome	Associate	32170921
Drug Related Side Effects and Adverse Reactions	Associate	10063354, 10224110, 10233855, 10383455, 10400831, 10447681, 10542136, 10744045, 12243341, 1381359, 14660619, 15000861, 15059848, 15623531, 1831797 View all (49 more)
Drug Related Side Effects and Adverse Reactions	Stimulate	10089905, 10759767, 10849002, 10936200, 10952020, 11118442, 11381677, 11500375, 11749798, 12125919, 1317349, 16483679, 16504042, 17498300, 17570844 View all (15 more)
Drug Related Side Effects and Adverse Reactions	Inhibit	16798876, 20392859, 24224954
Drug Resistant Epilepsy	Associate	35598439
Drug Resistant Epilepsy	Stimulate	9792306
Dry Eye Syndromes	Associate	20036239, 21245952, 25817729, 34048779, 35916880, 36208723
Dry Eye Syndromes	Stimulate	23169882, 27489152, 32476816, 39884388
Duane Retraction Syndrome	Associate	29912900
Dupuytren Contracture	Associate	23431165, 29983350
Dupuytren Contracture	Stimulate	26152183
Dysbiosis	Associate	30818349, 39741321
Dysentery	Associate	20348510
Dysentery Bacillary	Stimulate	9393836
Dysequilibrium syndrome	Associate	37052975
Dyskinesia Drug Induced	Stimulate	9516441
Dyskinesias	Inhibit	24278120
Dyskinesias	Associate	24278120, 31435075
Dyslipidemias	Associate	37531036
Dysmenorrhea	Associate	25315199, 34010983
Dysplastic Nevus Syndrome	Associate	21659535
Dyspnea	Stimulate	10498591
Dyspnea	Associate	31238711
Dystonia 3 Torsion X Linked	Associate	28017799, 32739252
Echinococcosis	Associate	10540165
Eclampsia	Associate	17593951
Eclampsia	Stimulate	22958187
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Associate	10428056, 19860911
Eczema	Inhibit	26559252
Eczema	Associate	29143979
Edema	Stimulate	27869150, 35260880
Edema	Associate	32357159, 39533623
Elbow Injuries	Associate	21161742
Embolism Air	Associate	24945146
Embolism Amniotic Fluid	Associate	25938217
Embolism Fat	Associate	22327199
Emergence Delirium	Stimulate	32988381
Emergence Delirium	Associate	34887385
Emphysema	Associate	23734748, 32946850, 33936110
Encephalitis	Stimulate	19479051, 24330827
Encephalitis	Associate	22276993
Encephalitis Japanese	Associate	22276993
Encephalitis Japanese	Stimulate	40536377
Encephalitis Tick Borne	Stimulate	31924650, 37261350
Encephalocele	Associate	17688691
Encephalocele	Stimulate	30511959
Endocarditis	Associate	10603382, 24165416
Endocarditis	Stimulate	26225421
Endocrine System Diseases	Associate	21891866
Endometrial Neoplasms	Associate	11285034, 16826583, 17013801, 21305022, 34712201, 37233761
Endometrial Neoplasms	Inhibit	12237915
Endometrial Neoplasms	Stimulate	32805626, 34528556
Endometriosis	Associate	12372447, 15950634, 16759923, 17555752, 19394608, 21640344, 23952049, 24133591, 24844917, 26191186, 27542948, 29771400, 31551156, 34539624, 37389684, 39458478 View all (1 more)
Endometriosis	Stimulate	17548071, 37095705
Endophthalmitis	Stimulate	30296277
Endotoxemia	Stimulate	19794059, 22709547
Endplate Acetylcholinesterase Deficiency	Associate	29529124
Enteritis	Associate	27347722
Enteritis	Stimulate	30908851
Enterocolitis	Stimulate	33891982
Enterocolitis Necrotizing	Associate	34418984, 39342173
Enterocolitis Necrotizing	Stimulate	8506954
Enthesopathy	Associate	17828345
Eosinophilia	Associate	32170921, 8514874
Eosinophilic Esophagitis	Associate	30578874, 36591238, 37972740
Epidermal Cyst	Associate	33683743
Epidermal Cyst	Stimulate	38132109
Epidermodysplasia Verruciformis	Stimulate	1919049, 23429285
Epidermolysis Bullosa Simplex	Associate	14660619
Epilepsies Partial	Associate	39259090
Epilepsy	Associate	33920713, 39259090
Epilepsy Absence	Stimulate	30152135
Epilepsy Temporal Lobe	Associate	23634661, 27006531, 36977552
Epileptic Syndromes	Associate	22891927
Episodic Ataxia	Associate	23527726
Epstein Barr Virus Infections	Stimulate	24696473, 9329960
Epstein Barr Virus Infections	Associate	8298133
Erectile Dysfunction	Stimulate	29233142
Erectile Dysfunction	Associate	39809170
Ermine phenotype	Associate	23732752
Erythema	Associate	18049455
Erythema Multiforme	Associate	10571738
Erythema Nodosum	Associate	10564558, 11411907, 19225544, 30652669, 32034084, 9486396
Erythema Nodosum	Stimulate	27474073
Erythrocytosis Familial 2	Associate	19062180
Escherichia coli Infections	Stimulate	31694333
Esophageal Neoplasms	Associate	19339270, 23082063, 25292072, 29028942, 36555705
Esophageal Squamous Cell Carcinoma	Associate	1351861, 24151445, 24324738, 24402574, 33374641, 33572115, 36357564, 39307133
Essential Hypertension	Associate	22438881, 26782547, 26989902
Essential Hypertension	Stimulate	26617860
Euthyroid Sick Syndromes	Associate	10930442
Exanthema	Associate	29142473, 33153894
Exfoliation Syndrome	Associate	19279689, 20029655
Eye Diseases	Associate	17032245
Eye Hemorrhage	Associate	11549610
Eye Infections	Associate	9038309
Fabry Disease	Associate	15941417, 17353161, 39234251
Fabry Disease	Stimulate	31221509, 34287477, 35417091
Facial Nerve Injuries	Stimulate	30551550
Fallopian Tube Diseases	Associate	12496205
Fallopian Tube Diseases	Stimulate	33092547
Familial cylindromatosis	Associate	16230348, 36553511, 37893484
Familial cylindromatosis	Inhibit	22832488
Familial Mediterranean Fever	Associate	14514692, 22593232, 31707933
Fanconi Anemia	Associate	12750172, 20068062, 22310912
Fanconi Anemia	Stimulate	12750172, 18055871, 21912593, 8118026
Fasciculation	Associate	24302570
Fasciitis Necrotizing	Associate	11093140
Fatigue	Associate	19926609, 20661026, 22475653, 22923002, 23530106, 24632226, 24872120, 30770760, 31238711, 32029067
Fatigue	Stimulate	25955845, 37179299
Fatigue Syndrome Chronic	Associate	20447453, 30929860, 32328064, 9201656
Fatigue Syndrome Chronic	Stimulate	21619669, 37179299, 9874656
Fatigue Syndrome Chronic	Inhibit	8568312
Fatty Liver	Stimulate	12032170
Fatty Liver	Associate	20140224, 22327199, 25474087, 27678360, 30345259
Fatty Liver Alcoholic	Stimulate	25474087
Fatty Liver Alcoholic	Associate	34440652
Femur Head Necrosis	Associate	18312678
Fetal Growth Retardation	Stimulate	18703994
Fetal Growth Retardation	Associate	26158499, 29664552, 39618207
Fetal Membranes Premature Rupture	Associate	10329893, 11737072, 12036088, 19956547, 20709392
Fever	Associate	11133897, 12439605, 1510423, 1911345, 19561472, 2022738, 2242421, 2302463, 30696839, 31286990, 31707933, 8975900
Fever	Stimulate	34831294, 38139402
Fibrocartilaginous embolism	Stimulate	19435506, 33660790
Fibrocartilaginous embolism	Associate	25893355, 28161709, 29656141, 29941029, 31322007, 31907065, 32626912, 33336720, 33378011, 33478594, 33869626, 34516336, 34663388, 35094651, 35265264, 37041597 View all (1 more)
Fibrocystic Breast Disease	Associate	17234183
Fibromyalgia	Associate	28928366
Fibrosarcoma	Associate	26535007, 3137305, 8816437
Fibrosis	Associate	10590064, 11389006, 12380901, 13130479, 14960532, 16610058, 18312678, 18314537, 20128678, 20715091, 21057163, 24707477, 26367274, 26807786, 26820153 View all (15 more)
Fibrosis	Stimulate	22330637, 24757288, 32612071, 32774066, 36674897
Fibrosis	Inhibit	33831572
Fibrous Dysplasia Polyostotic	Associate	23745338
Food Hypersensitivity	Stimulate	20825428
Fractures Bone	Associate	36749277, 37038178
Fractures Spontaneous	Associate	20140224
Fractures Stress	Associate	35130903
Fragile X Tremor Ataxia Syndrome	Stimulate	33285358
Frailty	Associate	26248682
Frailty	Stimulate	28225718
Frontotemporal Dementia	Associate	36890594
Fuchs' Endothelial Dystrophy	Associate	9234795
Fused Kidney	Associate	18369459
Gallbladder Neoplasms	Associate	18260730, 24676340
Gallstones	Stimulate	17148666
Gastrinoma	Associate	34750164
Gastritis	Associate	12121897, 22714811, 22749770, 25008775, 26504356
Gastritis	Inhibit	26088449
Gastritis	Stimulate	27196487
Gastritis Atrophic	Associate	15112338, 34104107, 35905420, 39259113
Gastro enteropancreatic neuroendocrine tumor	Associate	32156252
Gastroesophageal Reflux	Associate	10732760
Gastrointestinal Diseases	Associate	19322919, 22568453
Gastrointestinal Hemorrhage	Associate	36820674, 39194098
Gastrointestinal Neoplasms	Associate	1846553, 23852308
GATA2 Deficiency	Associate	19375652
GATA2 Deficiency	Inhibit	27409423
Gaucher Disease	Associate	10400826, 34576075
general anxiety disorder	Stimulate	20709414
general anxiety disorder	Associate	35866837
Genetic Diseases Inborn	Associate	8118026
Genital Neoplasms Female	Inhibit	2289205
Gerodermia osteodysplastica	Associate	32735324
Gerstmann Syndrome	Associate	17618104
Giant Cell Arteritis	Associate	10943865, 31162032, 37703805
Gingivitis	Stimulate	32130362, 35665507
Glassy cell carcinoma of the cervix	Associate	32527042
Glaucoma	Associate	20467456, 21917936
Glaucoma Angle Closure	Stimulate	36254076
Glaucoma Open Angle	Associate	22509108, 35052396
Glioblastoma	Associate	14641910, 1937574, 19383369, 1974176, 22396498, 22591734, 23538445, 24901050, 26017671, 28604685, 29016808, 31791385, 32326230, 34290231, 35186504 View all (10 more)
Glioma	Associate	10744043, 1282676, 1563013, 16042757, 17011514, 17565690, 18708058, 19383369, 22318540, 23640457, 24787244, 25261660, 28604685, 35418179, 35592520 View all (8 more)
Glioma	Inhibit	21279667, 33227992
Gliosis	Stimulate	31395092
Glomerulonephritis	Associate	21454254, 8455368, 9067916
Glomerulonephritis IGA	Associate	10916103, 11748357, 18256354, 30029622, 31392215, 32791747, 33936064, 35769467, 8301931
Glomerulonephritis IGA	Inhibit	11849463
Glomerulonephritis IGA	Stimulate	18256312, 18496506, 20484297, 40322064
Glomerulonephritis Membranous	Associate	17213876, 34289975, 7543624, 7778683, 9551397
Glomerulosclerosis Focal Segmental	Associate	28629718
Glomerulosclerosis Focal Segmental	Stimulate	31095586, 31581251
Glossitis Benign Migratory	Stimulate	11121150
Glucocorticoid Receptor Deficiency	Associate	30738043, 36139147
Glucose Intolerance	Associate	22012292
Glucose Metabolism Disorders	Associate	22012292, 32454945
Glucosephosphate Dehydrogenase Deficiency	Associate	17533220, 28893903
Glucosephosphate Dehydrogenase Deficiency	Stimulate	33050491
Glut1 Deficiency Syndrome	Stimulate	23671580, 27094771, 29874809, 34055987
Glut1 Deficiency Syndrome	Associate	39181516
Glycogen Storage Disease Type IV	Stimulate	25561807
Glycogen Storage Disease Type IV	Associate	33416081
Glycosuria Renal	Associate	38051374
Gonorrhea	Stimulate	10632875
Gout	Associate	27169898, 35378210, 36550178
Graft vs Host Disease	Associate	10556195, 10572111, 11520812, 11532353, 15284108, 18021367, 19392797, 20100586, 29142307, 30349527, 32183881, 8496391
Graft vs Host Disease	Stimulate	14993881, 20446793, 30142416, 35114361, 35486633
Gram Positive Bacterial Infections	Associate	31416821
Granuloma	Associate	10768979, 12000723, 19156215, 20017901, 23745338, 27158798, 31475008, 31992621, 32411623, 32566036, 38067175, 7684503, 8027394
Granuloma	Stimulate	16622230, 25141207
Granuloma Giant Cell	Associate	22157665
Granulomatosis with Polyangiitis	Stimulate	11982607
Granulomatosis with Polyangiitis	Associate	12000723, 15708894
Granulomatous Disease Chronic	Associate	11411907, 12000723, 17111046, 21058909, 23527726, 38309375
Granulosa Cell Tumor	Associate	23155381
Graves Disease	Stimulate	17032245, 17348243, 25226272
Graves Disease	Associate	18369459, 19250279, 23544060, 25127106, 29526119, 7902787
Graves Disease	Inhibit	8697623
Graves Ophthalmopathy	Associate	28119492, 29847668, 33542676, 36056316
Graves Ophthalmopathy	Stimulate	30576385
Growth Disorders	Associate	31482782
Guillain Barre Syndrome	Associate	16645971, 24174711, 33751722, 34763483, 38143756
Guillain Barre Syndrome	Stimulate	22010965
Haemophilus Infections	Stimulate	11349030
HAIR AN syndrome	Stimulate	23110196, 23967300
Hamartoma	Associate	20389100
Hamartoma Syndrome Multiple	Stimulate	12111782
Hand Foot and Mouth Disease	Stimulate	24367714
Hand Foot and Mouth Disease	Associate	26166120
Hand Foot Syndrome	Associate	22736425
Hashimoto Disease	Associate	17115419, 19250279, 25127106, 29526119
Hashimoto Disease	Stimulate	19250279, 39913970, 8697623
Head and Neck Neoplasms	Associate	21933882, 29802455, 31076897, 38376273
Headache	Stimulate	32534515
Hearing Loss	Associate	26392121, 28501927, 34758154
Hearing Loss Sensorineural	Associate	19833626, 28501927
Hearing Loss Sensorineural	Stimulate	32553077
Heart Defects Congenital	Stimulate	18274638
Heart Diseases	Associate	11796554, 15218506, 1928295, 24091885, 33060583, 34638889, 34867992, 36012347
Heart Diseases	Stimulate	15681825, 15840906, 27733811
Heart Diseases	Inhibit	31524235
Heart Failure	Stimulate	10614840, 14973143, 22615818, 22790687, 24074138, 30968846, 34456907, 34744513
Heart Failure	Associate	11796554, 14607202, 15556048, 15956282, 16427798, 17503796, 18353715, 22811738, 22921902, 31104495, 32844595, 33969695, 34787869, 35669500, 35775773, 36012347, 8609343 View all (2 more)
Heart Failure	Inhibit	12388275
Heart Rupture	Associate	29949169
Heart Septal Defects Ventricular	Associate	35909487
Heart Valve Diseases	Associate	19040616, 29653899
Heart Valve Diseases	Stimulate	19169931
Heat Stroke	Associate	29933531
Heavy Metal Poisoning	Associate	31652851
Helicobacter Infections	Associate	11533078, 15627645, 16085918, 22714811, 23451225, 24379597, 28746216, 33399167, 35110948, 36158129
Helicobacter Infections	Stimulate	26945693
HELLP Syndrome	Stimulate	24612145
Hemangioblastoma	Associate	7639324
Hemangioma Cavernous Central Nervous System	Associate	19164476
Hemangioma Cavernous Central Nervous System	Stimulate	37052042
Hematologic Diseases	Associate	27421001
Hematologic Neoplasms	Associate	22310912
Hematoma	Associate	28282868, 37038178
Hemochromatosis	Associate	10188109, 11389006
Hemochromatosis	Inhibit	1558977
Hemolysis	Stimulate	1911345
Hemolytic Uremic Syndrome	Associate	1333300, 17063173, 1911345, 21403867
Hemolytic Uremic Syndrome	Stimulate	25174507, 31924826, 40108621, 9767525
Hemophilia A	Associate	16926287, 21362111, 30650445
Hemorrhage	Associate	20534169, 28651907, 8342597
Hemorrhage	Stimulate	29567026
Hemorrhage	Inhibit	36941081
Hemorrhagic Fever Crimean	Associate	27304063
Hemorrhagic Fever with Renal Syndrome	Associate	31340562
Hemorrhagic Fevers Viral	Associate	8642644
Hemostatic Disorders	Associate	10652289
Hepatic Encephalopathy	Associate	21940902, 36293192
Hepatitis Alcoholic	Stimulate	25149528
Hepatitis Alcoholic	Associate	31158952
Hepatitis Autoimmune	Stimulate	28257599, 31191516
Hepatitis Autoimmune	Associate	37102762
Hepatitis B	Stimulate	12970895, 29682590, 31106596
Hepatitis B	Associate	15188512, 16127755, 19470388, 22695741, 23395388, 27509979, 31441603, 32532356, 37585994, 9238048, 9528902
Hepatitis B	Inhibit	24025329
Hepatitis B Chronic	Associate	15188512, 22086795, 22147985, 22695741, 24520324, 31441603, 32664850, 9528902
Hepatitis B Chronic	Stimulate	26416327
Hepatitis C	Associate	16610058, 22200181, 25022296, 27678360, 28456632, 32532356, 8591843
Hepatitis C	Stimulate	17131467, 20483710, 23109461, 26023919, 31279905
Hepatitis C Chronic	Associate	14960532, 16425360, 18063307, 27175704, 27644640, 32050950, 32532356
Hepatitis C Chronic	Stimulate	8591843, 9626579
Hepatitis E	Associate	17593951
Hepatitis Viral Human	Stimulate	17158635
Hepatitis Viral Human	Associate	17477814, 37585994, 7509363
Hepatoblastoma	Associate	17570844
Hereditary Angioedema Type III	Stimulate	18407820
Hereditary Autoinflammatory Diseases	Associate	19877056, 29358286, 30804083, 35529868
Hereditary Autoinflammatory Diseases	Inhibit	28974505
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16984377, 17234183, 22228181, 26112140, 29636110
Hereditary leiomyomatosis and renal cell cancer	Associate	10477736, 1632458, 2801887, 8443970
Heredodegenerative Disorders Nervous System	Associate	22195005, 25630602, 29301248
Hernias Diaphragmatic Congenital	Associate	37605849
Heroin Dependence	Inhibit	29915338
Herpes Labialis	Stimulate	32735468
Herpes Simplex	Stimulate	16423052, 20739519
Herpes Zoster	Associate	34322810
Hidradenitis Suppurativa	Associate	23096596, 26091259, 32841223, 32853177, 34724272, 37331331, 37997679, 38049071
Hidradenitis Suppurativa	Inhibit	31577850
Hip Injuries	Associate	29665766
Hip Injuries	Inhibit	34172608
Hippocampal Sclerosis	Associate	27006531
Hirschsprung Disease	Associate	31475008, 39199380
Histiocytosis Langerhans Cell	Associate	10590064
HIV Infections	Associate	10403920, 15327898, 15965202, 1700829, 1735193, 17511776, 18524817, 19107206, 1985116, 2034677, 20420684, 20722464, 20963937, 21915993, 22215422 View all (27 more)
HIV Infections	Inhibit	10973452, 19703016, 23071135, 23718561, 29538651, 37376629
HIV Infections	Stimulate	11696237, 18573939, 18985732, 19156215, 19347588, 21556959, 24650829, 25198707, 26244384, 29778672, 36271499, 8565282, 9067516, 9272912
HIV Seropositivity	Stimulate	1735193
Hodgkin Disease	Associate	1605306, 1632458, 17496310, 2386200, 24008079, 24141626, 2801887, 30065253, 33684151
HTLV I Infections	Stimulate	19079192, 1920627
HTLV I Infections	Associate	20956799, 7860769, 9021186, 9326234
Humoral Hypercalcemia Of Malignancy	Associate	17032245
Huntington Disease	Stimulate	37674148
Hyper IgM Immunodeficiency Syndrome Type 1	Inhibit	10207167
Hyper IgM Immunodeficiency Syndrome Type 1	Associate	19170966
Hyperaldosteronism	Associate	33316770, 39252231
Hyperandrogenism	Associate	11502808, 12161545, 23975191, 25083576, 30975191
Hypereosinophilic Syndrome	Associate	1972179, 8514874
Hypergammaglobulinemia	Associate	1985116
Hyperglycemia	Associate	10837498, 26997759, 32454945
Hyperglycemia	Stimulate	19262007, 20592773, 22266116, 22500980, 25888955, 25894202, 34493360
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	36517975
Hyperinsulinism	Associate	12855762, 7738205
Hyperinsulinism	Stimulate	14532168, 23484124
Hyperlipidemia Familial Combined	Associate	12032168
Hyperlipidemias	Associate	17823444, 19249901, 23789212, 30020508
Hyperlipoproteinemia Type II	Associate	16083882
Hyperlipoproteinemia Type II	Stimulate	16549444
Hyperoxia	Inhibit	10070569
Hyperoxia	Stimulate	10666108, 14617515, 31411059
Hyperoxia	Associate	9529979
Hyperplasia	Associate	12528110, 28851954, 33995367
Hyperplasia	Stimulate	24716596, 30303512, 9407493
Hypersensitivity	Associate	31577850
Hypersensitivity Delayed	Associate	1458689, 27383320
Hypertension	Associate	17346438, 21465273, 22493072, 25973747, 26198819, 26782547, 28033321, 28233393, 29940585, 30957546, 37782172
Hypertension	Stimulate	21558084, 33652665, 37838749
Hypertension Portal	Associate	24705150
Hypertension Pregnancy Induced	Associate	26752743
Hypertension Pregnancy Induced	Stimulate	39503530
Hypertension Pulmonary	Associate	31703702
Hypertensive Retinopathy	Associate	18575614, 26710229
Hypertensive Retinopathy	Stimulate	35979044
Hypertriglyceridemia	Stimulate	19249901
Hypertriglyceridemia	Associate	2695592
Hypertrophy	Stimulate	31108390, 34854353
Hypertrophy	Associate	33995367
Hypertrophy Left Ventricular	Stimulate	33879070
Hypobetalipoproteinemia Familial Apolipoprotein B	Associate	16936264
Hypocalciuric hypercalcemia familial type 1	Associate	38088554
Hypoglycemia	Associate	27456841, 36499023
Hyponatremia	Associate	33969695
Hypotension	Stimulate	10498591, 22080961
Hypothermia	Stimulate	17320940
Hypothyroidism	Associate	12799216
Hypothyroidism	Stimulate	1600267, 31560937, 39185088
Hypothyroidism	Inhibit	31350776
Hypoxia	Stimulate	10383461, 11023511, 12874281, 14982858, 16014034, 17114296, 17456758, 21535870, 22863020, 22866899, 24270813, 24659848, 24933425, 26974319, 27408996 View all (12 more)
Hypoxia	Associate	12829075, 21787418, 22005158, 26045843, 27558590, 27792771, 31935962, 32028672, 34526760, 35874989, 37246768, 40513998
Hypoxia	Inhibit	1373333, 30459756, 32665623, 7528138
Hypoxia Brain	Associate	11023511, 17763440, 22117975, 24270813, 26045843, 27558590, 32264730, 32593213
Hypoxia Brain	Stimulate	12699414, 16042757, 18765230, 28536432
Ichthyosis	Associate	27554821, 29803800
Idiopathic Noncirrhotic Portal Hypertension	Associate	11874890, 12801966, 14960532, 21455331, 26820153
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	23446058
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	29903529, 34887625
Idiopathic Pulmonary Fibrosis	Associate	10188109, 11282543, 15809201, 22037258, 26709222, 28314802, 28629363, 32213567, 37817229, 8362967
Idiopathic Pulmonary Fibrosis	Stimulate	36791050
IgA Deficiency	Associate	9508785
IgA Vasculitis	Associate	10102645, 10817565, 11817607, 11991968, 12746898, 17075836, 17530706, 20164300, 20929536, 23494522, 25436214, 26215036, 29217191, 30713533, 30724348 View all (6 more)
Ige Responsiveness Atopic	Associate	17121871, 24654313
Ileitis	Associate	21327025
Immune Reconstitution Inflammatory Syndrome	Associate	23002445, 23594560
Immune Reconstitution Inflammatory Syndrome	Stimulate	26611774, 28316373, 29538651
Immune System Diseases	Associate	11009084, 1893618, 20722464, 21402907, 23493554, 23943614, 33704915, 8096802
Immunodeficiency due to Defect in MAPBP Interacting Protein	Stimulate	35712257
Immunoglobulin a deficiency 1	Associate	11966768
Immunologic Deficiency Syndromes	Associate	12396374, 25329064, 26624524, 33013830, 7723241
Incisional Hernia	Associate	19397782
Incontinentia Pigmenti	Associate	11966763, 23079196
Infections	Stimulate	10024555, 10497105, 10768935, 10900340, 11909956, 12065506, 12540537, 14557666, 16232223, 16487684, 1677595, 17715326, 17923525, 18678660, 22513358 View all (22 more)
Infections	Inhibit	11179309, 16738534, 19276177, 20946625, 20980497, 22018491, 22727020, 34994081, 8500890
Infections	Associate	11462023, 11533078, 11918712, 12036088, 15518816, 15722350, 15845479, 15986373, 16081933, 16322091, 16859506, 17592300, 18715339, 19103526, 19353239 View all (38 more)
Infectious Mononucleosis	Inhibit	12799212
Infectious Mononucleosis	Associate	8298133
Inferior Wall Myocardial Infarction	Associate	36127647
Infertility	Associate	23209346, 29771400
Infertility Female	Associate	36608061
Infertility Male	Associate	26612435
Inflammation	Stimulate	10027419, 10477716, 10515411, 10688670, 10809757, 10850534, 11114294, 11133489, 11568005, 11851889, 12514595, 14514692, 14641910, 15199060, 15251468 View all (337 more)
Inflammation	Associate	10029160, 10195071, 10205200, 10231453, 10233853, 10339575, 10358077, 10371470, 10400827, 10408389, 10429980, 10438545, 10455128, 10540222, 10551799 View all (1667 more)
Inflammation	Inhibit	11981819, 16352667, 19158276, 21464084, 21784542, 21957872, 22080961, 23365670, 24848801, 31501002, 32485947, 33920713, 35909944, 37569456, 37816914
Inflammatory Bowel Disease 3	Associate	18698679
Inflammatory Bowel Diseases	Associate	10053016, 10403730, 11804840, 14678276, 14871291, 15223609, 16195422, 16760259, 17589947, 18536746, 18698679, 20014019, 20629103, 21903765, 22937039 View all (59 more)
Inflammatory Bowel Diseases	Stimulate	19664152, 28797042, 30429108, 31034508, 39487408
Inflammatory Breast Neoplasms	Associate	26207636, 27374101, 36202317, 40624675
Influenza Human	Associate	22269998, 23148654, 23526940, 23549267
Influenza Human	Stimulate	22554464, 24641803, 25254368, 26285213, 32436879, 38214784
Infratentorial Neoplasms	Associate	33902636
Insulin Resistance	Associate	11001753, 11287357, 11469400, 12006640, 12032168, 14532168, 15650331, 16132956, 16784178, 17015957, 19633828, 19645041, 21047923, 21057163, 21147642 View all (20 more)
Insulin Resistance	Stimulate	11342531, 17131467, 17227768, 17551966, 18443205, 19652946, 19769745, 23651848, 29409019, 30863203
Internal Hernia	Associate	34185172
Intervertebral Disc Degeneration	Associate	17688691, 19305384, 25304312, 26439025, 28586025, 29651107, 29656141, 29941029, 30076336, 30511959, 31056946, 31140325, 31322007, 33660790, 33869626 View all (5 more)
Intervertebral Disc Degeneration	Stimulate	19435506, 33251629
Intervertebral Disc Degeneration	Inhibit	34190406
Intervertebral disc disease	Associate	18302283, 20665551, 31056946, 35960059
Intervertebral disc disease	Stimulate	26774625, 33251629, 40244065
Intervertebral Disc Displacement	Associate	30511959, 33101543
Intestinal Diseases	Associate	15654837, 29142307, 8506954
Intestinal Fistula	Stimulate	21619579
Intestinal Obstruction	Associate	35528155
Intestinal Polyposis	Associate	38297356
Intra Articular Fractures	Associate	15828019
Intracranial Aneurysm	Associate	26198819, 31545495, 33511216
Intracranial Arteriovenous Malformations	Associate	17986934
Intracranial Hemorrhages	Associate	17986934, 29932521
Intracranial Hypertension	Stimulate	21676422
Intracranial Hypertension	Associate	35812382
Intrahepatic Cholestasis of Pregnancy	Stimulate	24489901
Intrauterine Growth Retardation Metaphyseal Dysplasia Adrenal Hypoplasia Congenita And Genital Anomalies	Stimulate	29567026
Intussusception	Stimulate	34284276
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	10540222, 29712918, 31301515
Invasive Pulmonary Aspergillosis	Stimulate	22731696
Iron Deficiencies	Associate	11737064, 18716131
Iron Overload	Associate	33969695
Irritable Bowel Syndrome	Associate	17170025, 24206549, 25927528
Irritable Bowel Syndrome	Stimulate	24667736, 34115808
Ischemia	Stimulate	29949169
Ischemic Stroke	Associate	23742289, 24817293, 33616302, 34921461, 34970793
Ischemic Stroke	Stimulate	30588195, 39394477
Job Syndrome	Stimulate	10400826
Job Syndrome	Associate	21792878
Joint Diseases	Associate	17828345, 19318316, 31566926, 34281218, 37373540, 9932110
Joint Diseases	Stimulate	29348703
Kashin Beck Disease	Stimulate	17945513
Keratitis Herpetic	Associate	32867704
Keratoconus	Associate	19304583, 22413749, 27207902
Keratoconus	Stimulate	29021606
Keratosis Actinic	Associate	23379751
Kidney Diseases	Associate	14613268, 23796916, 24610932, 29555686, 31871930, 32684830, 33969695, 34045516, 34501555, 37859695, 37965310, 8455368
Kidney Diseases	Stimulate	34359843, 39476943
Kidney Failure Chronic	Stimulate	12846752, 15600254, 27000486, 28651949
Kidney Failure Chronic	Associate	19684120, 29868028, 34045516
Kidney Failure Chronic	Inhibit	31875015
Kidney Neoplasms	Associate	18294286, 26500094, 29607933
Knee Injuries	Inhibit	25151085
Labor Pain	Stimulate	17823277
Labor Pain	Associate	33910460, 36190386
Labyrinth Diseases	Associate	26392121
Latent Tuberculosis	Associate	25520147, 25528189, 30627224, 31992621
Latent Tuberculosis	Stimulate	28651949
Lead Poisoning Nervous System	Associate	17408492, 23826419, 9038309
Lead Poisoning Nervous System	Stimulate	35164664
Leiomyoma	Associate	15193492, 15474092, 21138652, 22096007, 32372565, 36591830, 36771423
Leiomyoma	Stimulate	29809057
Leiomyomatosis	Associate	32372565
Leiomyosarcoma	Associate	37175660
Leishmaniasis	Associate	30108591, 31469834, 9096369
Leishmaniasis Cutaneous	Associate	15716079, 31469834, 32766167, 7595196
Leishmaniasis Diffuse Cutaneous	Inhibit	25397678
Leishmaniasis Diffuse Cutaneous	Associate	8443970
Leishmaniasis Mucocutaneous	Associate	31469834, 7595196
Leishmaniasis Visceral	Associate	31469834
LEOPARD Syndrome	Associate	31112872
Leprosy	Associate	10540222, 19058987, 20640364, 20650301, 21925494, 25992795, 30652669, 32372760, 32433683, 9486396, 9822276
Leprosy	Stimulate	24578538
Leprosy Lepromatous	Associate	10540222, 19058987, 20650301
Leprosy Lepromatous	Inhibit	26362198
Leprosy Tuberculoid	Associate	19058987, 38167007
Leptospirosis	Associate	26491036
Leptospirosis	Stimulate	31114579
Leukemia	Associate	10029601, 10318796, 10783388, 11264180, 11880365, 12149200, 12586626, 1370201, 15196924, 15922966, 16020509, 17673311, 18807213, 19759901, 20105430 View all (11 more)
Leukemia	Inhibit	3474039
Leukemia B Cell	Stimulate	33421548
Leukemia Biphenotypic Acute	Associate	35886021
Leukemia Hairy Cell	Associate	2114936, 8227350, 9136953
Leukemia Hairy Cell	Stimulate	2258703
Leukemia Large Granular Lymphocytic	Associate	12480700, 1327287, 17156396
Leukemia Large Granular Lymphocytic	Stimulate	23667543
Leukemia Lymphocytic Chronic B Cell	Associate	10666220, 10812246, 11122109, 12149200, 12492578, 1381243, 16517754, 16840734, 19387007, 2114936, 2169926, 22593611, 22945689, 23247726, 2539214 View all (10 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	1532590, 16113842, 2258703
Leukemia Lymphocytic Chronic B Cell	Inhibit	24166938, 29276179
Leukemia Lymphoid	Associate	1511460
Leukemia Lymphoma Adult T Cell	Associate	23557330, 2421578, 37832654
Leukemia Monocytic Acute	Associate	10765922, 27992360
Leukemia Monocytic Acute	Stimulate	25367297
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	1902397, 24041577, 24819026, 2496143, 32782381, 7780147
Leukemia Myeloid	Associate	15922966, 1688503, 18838202, 2022746, 2062856, 24307172, 2435341, 2537112, 8353281, 9565575
Leukemia Myeloid	Inhibit	2823943
Leukemia Myeloid Acute	Associate	10477734, 10812243, 12586626, 1381241, 1382704, 15922966, 1695108, 1714325, 18202225, 1825289, 21307400, 21520003, 23616009, 25795133, 26081440 View all (20 more)
Leukemia Myeloid Acute	Inhibit	1705566
Leukemia Myeloid Acute	Stimulate	29922294
Leukemia Myelomonocytic Chronic	Associate	10554809, 31648319
Leukemia Myelomonocytic Chronic	Stimulate	30026572
Leukemia Myelomonocytic Juvenile	Associate	10749583, 12010819, 8839857, 9185524, 9834232
Leukemia Promyelocytic Acute	Associate	15256426, 18039708, 28343272, 30237268, 3166411, 8193361
Leukemia T Cell	Associate	27565576, 31053105, 8132223
Leukemic Infiltration	Stimulate	35637476
Leukocytosis	Inhibit	22734496
Leukoencephalopathies	Stimulate	34359880, 36280708
Leukoencephalopathy Progressive Multifocal	Associate	21185609, 26531763
Lewy Body Disease	Associate	18186919
Lichen Planus	Associate	14962095, 26632637, 29526761, 9188868
Lichen Planus	Stimulate	39273670
Lichen Planus Oral	Associate	14962095, 26221924, 29335479, 37629739, 7738356
Lichen Planus Oral	Stimulate	18782324, 29813046
Lichenoid Eruptions	Inhibit	26559252
Light Fixation Seizure Syndrome	Stimulate	12065506
Lipodystrophy	Associate	18430964
Lipoma	Stimulate	12032170
Liposarcoma	Stimulate	11278855
Livedoid Vasculopathy	Associate	15327404
Livedoid Vasculopathy	Stimulate	37965310
Liver Cirrhosis	Associate	12801966, 18030367, 21212030, 22200181, 22695741, 23840511, 25467797, 27175704, 28865603, 31102558, 31847135, 31926856, 33291080, 36246566, 37995395
Liver Cirrhosis	Stimulate	17036394
Liver Cirrhosis Alcoholic	Associate	19278365
Liver Cirrhosis Biliary	Associate	17158635, 20578265, 23000144, 23392275, 28922472, 33512089, 33815355, 34367180, 9014820, 9932110
Liver Cirrhosis Biliary	Inhibit	1772964
Liver Cirrhosis Biliary	Stimulate	27668889, 31867004, 33512089, 36982376, 38228248
Liver Diseases	Associate	11244168, 16425355, 1900574, 22330637, 23343370, 23967134, 27678360, 30133944, 39173437, 7509363
Liver Diseases	Inhibit	1772964
Liver Diseases	Stimulate	29969462
Liver Diseases Alcoholic	Associate	15623531, 24224954, 38146363
Liver Failure	Associate	12393901, 20537485, 27678360, 29229400, 31441603, 34971708, 37175814
Liver Failure	Stimulate	33356606
Liver Failure	Inhibit	35164651
Liver Failure Acute	Inhibit	1772964
Liver Failure Acute	Associate	29229400
Liver Neoplasms	Associate	1847844, 26301107, 27487029
Liver Neoplasms	Stimulate	20433827
Locked In Syndrome	Stimulate	26360770
Low Back Pain	Associate	19877080
Lumbar Stenosis Familial	Associate	36277021
Lung Diseases	Associate	12566517, 15809210, 17306937, 19292764, 19835594, 24024324, 24553063, 26165383, 35680011, 38287362, 39249157, 9988757
Lung Diseases	Stimulate	25748325, 36480571
Lung Diseases	Inhibit	28169347
Lung Diseases Interstitial	Associate	20404807, 33139675, 34001401, 37561311, 37817229
Lung Injury	Associate	10400827, 1597474, 17332138, 27917620, 32934806, 8362967
Lung Neoplasms	Associate	10945495, 12540537, 1299622, 1337797, 15527763, 18286287, 19448410, 22675434, 23437179, 24024324, 24113849, 24894428, 25268596, 25548907, 25897826 View all (12 more)
Lung Neoplasms	Stimulate	31552680, 32805626, 35184748
Lupus Erythematosus Cutaneous	Associate	10998151, 12230503, 12485445, 15334474, 15692985, 16096331, 30227141, 7616001
Lupus Erythematosus Discoid	Associate	15800006
Lupus Erythematosus Systemic	Associate	10643708, 10998151, 12562402, 13130473, 15565953, 15728381, 15800006, 17276734, 17665457, 18759295, 19121222, 19423430, 19479852, 20434119, 2105500 View all (28 more)
Lupus Erythematosus Systemic	Stimulate	10733475, 15751081, 16507146, 18438838, 19199277, 20954190, 25548434, 25762184, 26079624, 26790609, 28485798, 29142473, 29316941, 31808546, 31871930, 39818255 View all (1 more)
Lupus Erythematosus Systemic	Inhibit	1893618, 19644848, 31049024, 35833144, 36740569
Lupus Nephritis	Stimulate	16408116
Lupus Nephritis	Associate	2105500, 28527290, 31171837, 31409832
Lyme Neuroborreliosis	Stimulate	11985531
Lymphatic Metastasis	Associate	25010932, 26464679, 29575464, 33158173
Lymphatic Metastasis	Stimulate	28791816
Lymphohistiocytosis Hemophagocytic	Associate	17456766, 1954380, 9329960
Lymphoma	Associate	11013462, 14978135, 18550789, 19201837, 19359411, 19717436, 20191326, 2066357, 20963937, 22125456, 2302463, 25962811, 26307954, 29504848, 30065253, 31118164 View all (1 more)
Lymphoma	Stimulate	11274761, 11956026, 35432366
Lymphoma B Cell	Associate	2066357, 20952689, 22649007, 23640160, 24039967, 26448050, 27235588, 35244686, 7518925
Lymphoma B Cell	Stimulate	22666399
Lymphoma B Cell Marginal Zone	Associate	18796628
Lymphoma Extranodal NK T Cell	Associate	26108796
Lymphoma Follicular	Associate	10583231, 11756183, 16643431, 16763612, 18990758, 25733581
Lymphoma Follicular	Stimulate	22015774
Lymphoma Large B Cell Diffuse	Associate	16643431, 18633131, 18796628, 18990758, 20047977, 20191326, 23640160, 23840460, 25962811, 28060727, 31731887, 31886296, 32986381, 33664848, 7989309, 9572991, 9727032 View all (2 more)
Lymphoma Mantle Cell	Associate	20047977
Lymphoma Non Hodgkin	Associate	11092613, 11274761, 12351419, 12472577, 14978135, 1649557, 16643431, 18990758, 19390683, 19606255, 19654554, 20047977, 20191326, 20952689, 22096508 View all (12 more)
Lymphoma Non Hodgkin	Stimulate	22820139, 25422198
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	19890350
Lymphoma Primary Effusion	Associate	28931678
Lymphoma T Cell	Associate	17456766, 24635218, 7706285, 9593751
Lymphoma T Cell	Inhibit	19717436
Lymphoma T Cell	Stimulate	9329960
Lymphoma T Cell Cutaneous	Inhibit	1600267
Lymphoma T Cell Cutaneous	Associate	17495957
Lymphoma T Cell Peripheral	Associate	10748876
Lymphopenia	Associate	37848421, 40513998
Lymphoproliferative Disorders	Associate	1327287, 19738620, 2114936, 27402301
Lymphoproliferative Disorders	Stimulate	2258703, 8698322
Macrophage Activation Syndrome	Associate	24098711, 8632999
Macrophage Activation Syndrome	Stimulate	8556479
Macular Degeneration	Associate	24439028, 27733811, 39959181
Macular Degeneration	Stimulate	35370941
Macular Edema	Associate	37924741
Majeed syndrome	Associate	33314777
Malaria	Associate	1500203, 15941417, 16705810, 24903666, 26448013, 31138740, 33424841, 37215099, 9096369
Malaria	Stimulate	18716131, 24681005, 26902728, 34962938, 8975900, 9626052
Malaria	Inhibit	27027867, 30380038
Malaria Cerebral	Associate	15941417, 16705810, 20011600, 20642847
Malaria Cerebral	Stimulate	21298033
Malaria Falciparum	Associate	15941417, 26519199
Malaria Vivax	Associate	25038626
Male pseudohermaphroditism due to defective LH molecule	Stimulate	19252096
Malformations of Cortical Development Group I	Associate	10224136, 17545681
Malformations of Cortical Development Group I	Stimulate	16051302, 18045590, 22433871, 32229084, 34257809
Malnutrition	Associate	12032170
Malnutrition	Stimulate	31398886
Mandibular Nerve Injuries	Associate	21925494
Marburg Virus Disease	Stimulate	8642644
Marfan Syndrome	Associate	37445606
Mast Cell Activation Disorders	Stimulate	10643713
Mast Cell Activation Disorders	Associate	33882986
Mastocytosis Systemic	Associate	18186919
Mastodynia	Associate	28764974
Measles	Associate	17538120, 18715339
Mediastinal Neoplasms	Associate	7813103
Medulloblastoma	Stimulate	20433827
Medulloblastoma	Associate	21327638
Melanoma	Associate	10318823, 11399512, 12713589, 1281617, 12966436, 1347555, 1380648, 15054471, 15580309, 16645588, 16801397, 16835788, 19651643, 2007858, 20856146 View all (27 more)
Melanoma	Stimulate	12445207, 1370233, 20052413, 23732752
Melanoma Cutaneous Malignant	Associate	19626699
Melioidosis	Associate	28475641
Melkersson Rosenthal Syndrome	Associate	23527726
Memory Disorders	Associate	23530106
Meniere Disease	Associate	34920656
Meningioma	Associate	26943583
Meningitis Bacterial	Associate	16705810, 2022738, 21473761, 26316174
Meningitis Cryptococcal	Associate	23493728
Meningitis Meningococcal	Stimulate	11598066
Meningitis Meningococcal	Associate	23865742
Meningitis Viral	Associate	27914455
Meningococcal Infections	Associate	10816518
Mental Disorders	Associate	31786499, 31954374
Mesangial sclerosis diffuse	Associate	29708439
Mesothelioma	Associate	15700263, 7947089
Mesothelioma Malignant	Associate	12612292, 15756029
Mesothelioma Malignant	Stimulate	23868066
Metabolic Diseases	Associate	12161545, 15677734, 17498300, 26722602, 30964608, 33417721, 33585287, 34779349
Metabolic Diseases	Stimulate	21852675
Metabolic Syndrome	Associate	17347550, 21147642, 21498926, 23010875, 25081719, 26722602, 29696068, 30345259, 30383538, 30635365, 31798282, 33033337, 39837875
Metabolic Syndrome	Stimulate	22991262
Mevalonate Kinase Deficiency	Stimulate	13130485
Microcephaly	Associate	33672623
Migraine Disorders	Associate	19559392, 25315199, 28208835, 36614097, 39187749
Migraine with Aura	Associate	19559392
Miller Fisher Syndrome	Associate	16645971
MINOCA	Stimulate	28931782
Mitochondrial Diseases	Associate	10383455, 12522001, 15623531, 29207128, 36047722, 37312126, 37656622
Mitochondrial Diseases	Inhibit	23705001
Mitochondrial Diseases	Stimulate	30897288, 33957885, 34867992, 36361846, 36982291, 39173437
Mitral Valve Insufficiency	Associate	33831572
Mixed Connective Tissue Disease	Stimulate	25736140
Mixed Tumor Malignant	Associate	15921527
Mohr Tranebjaerg syndrome	Stimulate	1401076
Monoclonal Gammopathy of Undetermined Significance	Associate	10050719
Mononeuropathies	Associate	17763415
Mood Disorders	Associate	23064081
Mouth Diseases	Associate	10606965, 23226210, 23553861, 24453419, 27542948, 8537046
Mouth Diseases	Stimulate	20008541
Mouth Neoplasms	Stimulate	19528505
Mouth Neoplasms	Associate	19528505, 30536317, 38376273, 8286215
Mpox (monkeypox)	Associate	36356606, 37006463
Mucocutaneous Lymph Node Syndrome	Stimulate	10233729, 28069066, 32884012, 34035116
Mucocutaneous Lymph Node Syndrome	Associate	14703611, 15383707, 23298273, 26679344, 26794462, 32721809, 3491174, 35125343, 35692878, 35861833, 37820655, 38273388
Mucositis	Associate	25915602, 32612071, 34697283
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Associate	32761064
Multiple Myeloma	Associate	10050719, 10210775, 10848780, 12200397, 12714512, 15842659, 18512025, 19191868, 21850048, 23632478, 24141333, 24875904, 25469832, 27039718, 29089645, 30872779, 31406107, 36105747 View all (3 more)
Multiple Myeloma	Stimulate	11986233, 15287939
Multiple Myeloma	Inhibit	25526031
Multiple Organ Failure	Associate	15288631, 18088351, 22487520, 23796916
Multiple Sclerosis	Associate	10428056, 10550297, 14641910, 17212772, 17258784, 18322311, 22059991, 22801493, 23028349, 23661562, 24098530, 24278027, 25136908, 25704169, 26062845 View all (17 more)
Multiple Sclerosis	Stimulate	11956029, 12562396, 21298033, 23226199, 27916909, 9013604, 9771978
Multiple Sclerosis Chronic Progressive	Associate	23319192
Multiple Sclerosis Chronic Progressive	Stimulate	24098530
Muscle Neoplasms	Associate	20110400, 28114971, 29687616
Muscle Neoplasms	Inhibit	37013268
Muscular Atrophy	Associate	17609255, 18156397, 19470832, 25630602
Muscular Atrophy	Stimulate	37013268, 38004107
Muscular Diseases	Associate	30178857, 35468098
Muscular dystrophy congenital with central nervous system involvement	Associate	15565953
Muscular Dystrophy Duchenne	Stimulate	21842588
Musculoskeletal Diseases	Inhibit	19160133
Myasthenia Gravis	Inhibit	25518708
Myasthenia Gravis	Associate	28045063, 28119492
Mycobacterium avium intracellulare Infection	Associate	12847679, 19281567, 24816497
Mycobacterium avium intracellulare Infection	Stimulate	36678131
Mycobacterium Infections Nontuberculous	Associate	27686649, 29712918, 8960473
Mycoses	Associate	20646338, 30169607
Mycosis Fungoides	Associate	12689942, 20047977
Myelodysplastic Syndromes	Associate	10749583, 16091127, 18081437, 18945969, 20061558, 20472834, 20541027, 20562331, 21659535, 24652987, 27513856, 33050756, 35367529, 9883804
Myelodysplastic Syndromes	Stimulate	18287021, 38511647, 9792306
Myelodysplastic Syndromes	Inhibit	25608238, 34335093, 36737440
Myeloperoxidase Deficiency	Associate	37954595
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	18563738
Myeloproliferative Syndrome Transient	Stimulate	11966768
Myocardial Infarction	Associate	11693755, 14711179, 21455632, 22408428, 33847684
Myocardial Infarction	Stimulate	20467748
Myocardial Ischemia	Associate	29940585, 33191336, 36012347
Myocarditis	Associate	11028485, 34414385
Myocarditis	Stimulate	15218506, 34796122
Myoma	Associate	23690221
Myopathies Structural Congenital	Associate	26799286, 32798993, 38037545
Myopathy with Giant Abnormal Mitochondria	Associate	28317877
Myopia	Associate	34160912
Myositis	Associate	15731288, 20980264, 27894310, 27936488, 37228600, 39946176
Myositis Inclusion Body	Stimulate	18420712
Myotonic Dystrophy	Associate	15217754, 21414848
Myotonic Dystrophy	Inhibit	26211001
Myotonic Dystrophy	Stimulate	27294162, 30845774, 32684830, 33287713
Narcolepsy	Associate	11235856, 32358372
Narcolepsy	Stimulate	27821550
Nasal Polyps	Associate	19405090, 36139155, 8514874
Nasal Polyps	Stimulate	30040868, 33785041
Nasopharyngeal Carcinoma	Associate	11968052, 16970270, 21057457, 22320262, 26198046, 32448862, 34114393, 34452547
Nasopharyngeal Carcinoma	Stimulate	28207826
Nasopharyngeal Neoplasms	Stimulate	33545035
Neck Pain	Stimulate	38097400
Necrobiotic Xanthogranuloma	Stimulate	24428816
Necrosis	Stimulate	10373561, 11278357, 15218506, 15699214, 18550789, 22345571, 22421439, 24336085, 28485798, 34625123, 37924741, 8901602
Necrosis	Associate	11918694, 15461705, 16507998, 17565690, 19156215, 28097431, 30999696, 8675695
Neointima	Associate	11703589, 17945513, 24080827
Neonatal Systemic lupus erythematosus	Stimulate	12960355
Neonatal Systemic lupus erythematosus	Associate	15334474, 22031281
Neoplasm Invasiveness	Associate	15217507, 27175588, 37575220
Neoplasm Metastasis	Associate	11282551, 15528190, 16908592, 19087274, 19533666, 20978325, 21057457, 21486440, 23326309, 23493346, 24197984, 25010932, 26106605, 26112140, 26792858 View all (15 more)
Neoplasm Metastasis	Inhibit	15625605, 34994069
Neoplasm Metastasis	Stimulate	22952657, 23431386, 23999825, 25503960, 26655845, 28386055, 32670264, 36301038
Neoplasm Recurrence Local	Associate	24402574
Neoplasm Residual	Stimulate	27682210
Neoplasms	Associate	10224110, 10408834, 10436007, 10469042, 10526158, 10541965, 10732775, 10744045, 10891490, 10945495, 11044363, 11118442, 11282551, 11342564, 11676830 View all (380 more)
Neoplasms	Inhibit	10369458, 10601837, 11278357, 14970864, 16438713, 2289205, 24656965, 24894428, 25225903, 25380463, 27409423, 30682105, 31412918, 32805626, 33924332 View all (5 more)
Neoplasms	Stimulate	10543258, 15308326, 15497022, 1707692, 1739610, 18294286, 19528505, 20509143, 20607236, 22029859, 2258703, 22728043, 23667543, 23999825, 25561807 View all (22 more)
Neoplasms Adipose Tissue	Associate	19553556, 21197447, 24966465, 26113076, 27735943, 31434495
Neoplasms Adipose Tissue	Stimulate	28566469, 7738178
Neoplasms Basal Cell	Associate	8100398
Neoplasms Glandular and Epithelial	Associate	16164629, 16489115, 26753875
Neoplasms Squamous Cell	Associate	27132513
Nephritis	Associate	13130473, 22057071, 30779760, 8258957
Nephritis	Stimulate	33299497
Nephritis Interstitial	Stimulate	17361117
Nephritis Interstitial	Associate	30088539, 30779760
Nephrosis congenital	Stimulate	28963877
Nephrosis congenital	Associate	29190601
Nephrotic Syndrome	Associate	12974763, 28629718, 31095586, 35837376
Nephrotic Syndrome	Stimulate	20446793
Nerve Degeneration	Stimulate	19435506, 21298033, 35637476
Nerve Degeneration	Associate	34625123, 35889920, 36890594
Nervous System Diseases	Associate	11032886, 21891866, 39738562
Netherton Syndrome	Stimulate	27554821
Neu Laxova syndrome	Stimulate	36216277
Neural Tube Defects	Associate	18162123
Neuralgia	Associate	35867896, 37175520
Neuroblastoma	Associate	10100634, 10936200, 11282550, 12709435, 17962944, 19638467, 21298033, 23967300, 25503960, 32514618, 8640845
Neuroblastoma	Inhibit	30629318
Neurodegenerative Diseases	Associate	11450703, 14641910, 18422522, 21845541, 26439025, 31810488, 32854421, 35748636, 35889920, 39456170
Neurodegenerative Diseases	Stimulate	16705810, 21298033, 9013604
Neuroectodermal Tumors Primitive Peripheral	Associate	9201246
Neuroendocrine Tumors	Associate	8826857
Neurofibromatosis 1	Stimulate	27448806
Neurofibrosarcoma	Associate	18650488
Neuroinflammatory Diseases	Associate	16606644, 17989372, 23634661, 23768161, 30409508, 32688141, 33113430, 34625123, 35259429, 36376607, 36903325, 37548929, 40710309
Neuroinflammatory Diseases	Stimulate	37445907
Neurologic Manifestations	Associate	16645971, 23064081, 29751779
Neurologic Manifestations	Stimulate	34450402
Neuroma Acoustic	Associate	29018206
Neurotoxicity Syndromes	Stimulate	11927634, 26492598
Neurotoxicity Syndromes	Associate	19091752, 30582668, 31395092
Neutropenia	Associate	27421001, 9325020
Neutropenia severe chronic	Associate	16982324
Neutrophil Immunodeficiency Syndrome	Associate	17003486
Neutrophilia Hereditary	Stimulate	12200521, 24750386
Nevus Pigmented	Associate	7963661
Niemann Pick Disease Type C	Associate	29912899, 34943986, 35730622
Niemann Pick Disease Type C	Stimulate	31666429
Night blindness congenital stationary	Associate	18186919
No Reflow Phenomenon	Stimulate	32245321
NOG Related Symphalangism Spectrum Disorder	Associate	37802268
Non alcoholic Fatty Liver Disease	Stimulate	18469261, 20720266
Non alcoholic Fatty Liver Disease	Associate	21057163, 26148245, 30137403, 31659105, 35069014, 35469222, 37861538
Non alcoholic Fatty Liver Disease	Inhibit	36093484
Non Radiographic Axial Spondyloarthritis	Associate	16385498, 23062122
Nonseminomatous germ cell tumor	Associate	37242266
Nonsyndromic Holoprosencephaly	Stimulate	35552657
Norrie disease	Associate	33446687
Nose Diseases	Associate	19405090, 31495191
Obesity	Associate	11287357, 12006640, 12690081, 12855762, 14981227, 15217754, 15489542, 15650331, 16464856, 16784178, 16968396, 17381056, 17498300, 19022640, 19196817 View all (66 more)
Obesity	Stimulate	15837949, 18390990, 19584886, 19633828, 19769745, 20943792, 21465273, 21558084, 22309242, 23110196, 23958744, 24262292, 25833255, 26273678, 26694359 View all (20 more)
Obesity	Inhibit	24741586
Obesity Maternal	Associate	28625035, 28994813
Obesity Morbid	Associate	32545403
Obsessive Compulsive Disorder	Associate	22311210
Obstetric Labor Premature	Associate	12036088, 20965572
Obstetric Labor Premature	Stimulate	19272692
Occupational Stress	Associate	17408492
Oculocutaneous albinism type 2	Stimulate	31415412
Odontoma	Associate	23152884
Oliver Syndrome	Associate	25759826
Open Bite	Associate	35830630
Opioid Related Disorders	Associate	30071446
Opioid Related Disorders	Inhibit	31687981
Opportunistic Infections	Stimulate	9770527
Optic Nerve Diseases	Associate	22126795
Oral Ulcer	Associate	8973622
Organizing Pneumonia	Associate	35373411
Orofacial Cleft 1	Associate	1352354, 1679292, 8105683
Osseous Heteroplasia Progressive	Stimulate	28575129
Osteoarthritis	Associate	10088775, 10806049, 11352237, 15880345, 16141526, 16311048, 16492401, 16757188, 17386086, 17434489, 17945513, 18547825, 18565252, 19264156, 20515435 View all (46 more)
Osteoarthritis	Stimulate	15731292, 21352802, 29128509, 29665766, 31042308, 32767318, 35733134, 35955467, 40429765
Osteoarthritis	Inhibit	16679036, 38132170
Osteoarthritis Hip	Associate	33407301, 34370345
Osteoarthritis Knee	Associate	12932288, 32409720, 32917098, 34735544, 37573584
Osteoarthritis Knee	Stimulate	21538317, 32912331, 36216277
Osteoarthropathy Primary Hypertrophic	Stimulate	28851954
Osteogenesis imperfecta type 1A	Associate	35711453
Osteoglophonic dwarfism	Stimulate	32096202, 32417847
Osteolysis	Associate	11518271, 14606512, 19860911, 35798734
Osteonecrosis	Associate	22975999
Osteoporosis	Associate	12237295, 12396374, 12396377, 22897816, 23343370, 25384921, 29521042, 29745905, 31571846, 31887189, 32080087, 35791093, 36077598, 36311708, 36316863 View all (6 more)
Osteoporosis	Stimulate	18407820, 37038178
Osteoporotic Fractures	Associate	12396374, 29521042, 34059576
Osteoporotic Fractures	Stimulate	40065254
Osteosarcoma	Associate	10187798, 10691855, 10849374, 26097610, 30403180, 32686984, 9109391
Otitis	Associate	24434259
Otitis Media	Associate	19522649, 19728873
Otitis Media with Effusion	Associate	11282555
Ovalocytosis Hereditary Hemolytic with Defective Erythropoiesis	Associate	30546074
Ovarian Cysts	Associate	26003810
Ovarian Diseases	Associate	16908592, 26191186, 30975191, 37883761
Ovarian Neoplasms	Associate	10098742, 10811499, 1401076, 16908592, 23300534, 23469193, 24376747, 24676340, 25446129, 27206315, 28664898, 30697874, 3180149, 32020859, 32192517 View all (10 more)
Ovarian Neoplasms	Stimulate	19484142, 27068525, 27458100, 37322531, 37644468
Overtraining Syndrome	Inhibit	38319611
Overweight	Associate	12855762, 32019154
Overweight	Stimulate	22773729, 34283808, 39336564
Pain	Associate	18990769, 20590345, 23864770, 26245191, 28668088, 28764974, 29128509, 31056946, 31238711, 34071008, 34602367, 35845981, 37573322, 39201416, 39729404
Pain	Stimulate	22776106, 22875918, 28928366, 29348703, 31221509, 37175520
Pancreatic Intraductal Neoplasms	Associate	37575220
Pancreatic Neoplasms	Associate	11572767, 14612914, 18163903, 21880146, 24146961, 24471499, 27143262, 30426611, 30558665, 30696421, 31424683, 32867538, 33661995, 33760162, 33804148 View all (9 more)
Pancreatic Neoplasms	Inhibit	25274283
Pancreatitis	Associate	18480551, 20396411, 22487520, 28935577
Pancreatitis	Stimulate	23608755, 31314190, 34599510
Pancytopenia	Stimulate	17666371
Papillomavirus Infections	Associate	17452777, 26079218, 26191295, 29935877, 35463689
Paralysis	Associate	24574500, 26843329
Paramyxoviridae Infections	Associate	19922606
Paraneoplastic Syndromes	Stimulate	32771066
Paranoid Disorders	Associate	30254506, 30627222
Paraparesis Tropical Spastic	Associate	2091326, 22335964, 26609200, 30466392, 33767694, 9636190
Paraparesis Tropical Spastic	Stimulate	8785452
Parasitemia	Stimulate	26902728
Parasitemia	Inhibit	27080559
Parkinson Disease	Stimulate	10212304, 25481834, 27735031, 32375873, 34955458, 36301901, 38231411, 9013604
Parkinson Disease	Inhibit	18197754
Parkinson Disease	Associate	22952715, 23745338, 24593806, 26911448, 28943632, 29710331, 31828965, 33608417, 34943986, 36306116, 36768317, 36926335, 39684585
Paroxysmal ventricular fibrillation	Associate	18228126
Pathological Conditions Anatomical	Associate	27094771, 27678360
Peanut Hypersensitivity	Associate	12671056
pediatric multisystem inflammatory disease COVID 19 related	Stimulate	34035116
pediatric multisystem inflammatory disease COVID 19 related	Associate	35863846
Peeling Skin Syndrome	Stimulate	32749463
Pemphigoid Benign Mucous Membrane	Associate	17488321
Pemphigoid Bullous	Associate	21224056, 29335495, 31001258, 35140724
Pemphigoid Bullous	Stimulate	31440247
Pemphigus	Associate	14760938, 30116153, 31681304
Penile Induration	Inhibit	18778497
Peptic Ulcer	Associate	12121897, 25368751, 33399167
Peri Implantitis	Stimulate	30158834, 38265340
Peri Implantitis	Associate	36267464
Periapical Granuloma	Associate	19026878, 25141207
Periapical Periodontitis	Associate	29898177
Periapical Periodontitis	Stimulate	35300329
Periodic fever familial autosomal dominant	Associate	15818692, 20943039, 26202849, 31009059, 31249574
Periodic fever familial autosomal dominant	Stimulate	35886575
Periodontal Diseases	Associate	18435806, 20679442, 23368949, 27815441, 28637950, 30890897, 35665507, 39337647, 9605989
Periodontitis	Associate	23046796, 28341818, 28736819, 31978095, 32618013, 37986309
Periodontitis	Stimulate	32130362, 34213019, 34484192, 34502071, 35665507
Peripheral Arterial Disease	Associate	19778662, 32835907
Peripheral Arterial Disease	Stimulate	25095746, 28406704
Peripheral Nerve Injuries	Associate	28852045
Peripheral Nervous System Diseases	Associate	17828345
Peripheral Nervous System Diseases	Stimulate	27981790
Periprosthetic Fractures	Associate	18612013, 29305046
Periprosthetic Fractures	Stimulate	24307062
Peritonitis	Associate	11135059, 21589907, 26453957, 39739693, 8807591
Peritonitis	Stimulate	23392590, 26069103
Peritonitis	Inhibit	34360900
Persian Gulf Syndrome	Associate	25514671
Persistent Infection	Stimulate	32408187
Persistent Infection	Inhibit	34350463
Personality Disorders	Associate	25172408, 32592356
Phenylketonurias	Associate	36312597
Pigmentation Disorders	Associate	23732752
Pituitary Neoplasms	Associate	27050975
Placenta Diseases	Stimulate	10952020
Placenta Diseases	Associate	30402038
Plaque Amyloid	Associate	18186919
Plaque Amyloid	Stimulate	37219933
Plaque Atherosclerotic	Associate	1698022, 20536609, 21075101, 26710229, 26755473, 8506944, 9852101
Plaque Atherosclerotic	Stimulate	27771154, 34269613
Plasma Cell Granuloma Pulmonary	Associate	11918694
Plasmacytoma	Stimulate	3493322
Pleural Effusion	Associate	1371640
Pleurisy	Stimulate	26367274
Pneumonia	Associate	17665457, 20811626, 22269998, 22734496, 24037182, 24804995, 27000486, 27155584, 30157804, 33270503, 33347836, 36034211, 39339947, 9452482
Pneumonia	Stimulate	22342787, 31257245, 33855076
Pneumonia	Inhibit	34944055
Pneumonia Bacterial	Stimulate	20646008
Pneumonia Lipid	Associate	15809899, 17362351, 28846666
Pneumonia Mycoplasma	Stimulate	29849498
Pneumonia Mycoplasma	Associate	33347836
Pneumonia Pneumococcal	Associate	19608588
Pneumonia Pneumocystis	Associate	9353066
Pneumonia Ventilator Associated	Associate	32940422
Polycystic Kidney Diseases	Associate	26666710
Polycystic Ovary Syndrome	Associate	12161545, 21970639, 23975191, 25083576, 26979943, 28949260, 28993561, 30975191, 34967266, 35485360, 35551681, 36793022, 37140276
Polycystic Ovary Syndrome	Stimulate	23118428, 28868943, 30134857, 32140727, 34873972
Polycythemia Vera	Associate	24463275, 34059095
Polycythemia Vera	Stimulate	35025147
Polyendocrinopathies Autoimmune	Associate	19037923
Polyendocrinopathies Autoimmune	Stimulate	36627721
Polymyalgia Rheumatica	Associate	10943865, 22004920
Polymyositis	Stimulate	19953283
Polyomavirus Infections	Stimulate	36512270
Polyps	Associate	30040868
Polyps	Stimulate	31495191
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	27175635
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Stimulate	37638717
Polysaccharide Storage of Unusual	Associate	22226452
Popliteal Artery Aneurysm	Inhibit	20488324
Post Acute COVID 19 Syndrome	Associate	37753077, 39578766
Post Infectious Disorders	Stimulate	22303462
Post Infectious Disorders	Associate	34462533
Postoperative Cognitive Complications	Associate	28599629
Postoperative Cognitive Complications	Stimulate	29949172
Postoperative Complications	Associate	26165383
Postoperative Hemorrhage	Associate	26052959, 28599629
Postpoliomyelitis Syndrome	Associate	22776106
Prader Willi Syndrome	Associate	37251380
Pre Eclampsia	Associate	12099552, 14982858, 17593951, 18276934, 19407822, 20668109, 22380486, 22493072, 22947907, 25769431, 25879409, 26970370, 27999241, 27999242, 28566469 View all (8 more)
Pre Eclampsia	Stimulate	24612145, 25461403, 26053021, 27604418, 30133944, 31154903, 31521202, 33979559, 35409108, 36683689, 38096686, 38382266
Precancerous Conditions	Stimulate	18957495
Precancerous Conditions	Associate	19484142, 25458044
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	2018837
Precursor Cell Lymphoblastic Leukemia Lymphoma	Stimulate	2066357
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	35886021, 37530244, 39658797
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11703324, 12472577, 21911919, 28341814, 39984900
Prediabetic State	Associate	32509152
Preeclamptic toxemia	Associate	12099552, 17593951, 19407822, 21224082, 21496272, 31154903, 37603530
Preeclamptic toxemia	Stimulate	21253506, 26053021, 29172779, 31138166
Pregnancy Complications	Stimulate	26844497
Pregnancy Complications	Associate	35255856
Pregnancy Tubal	Stimulate	31088412
Premature Birth	Associate	10329893, 11737072, 12947552, 18951205, 20224765, 20965572, 21173653, 21627550, 27748297, 34195300
Premature Birth	Stimulate	17940116, 23068965, 36027951
Pressure Ulcer	Stimulate	21676422
Pressure Ulcer	Associate	37746975
Preterm Premature Rupture of the Membranes	Associate	10329893, 12036088, 19272692, 20709392
Primary Immunodeficiency Diseases	Associate	16426002
Primary Myelofibrosis	Associate	27304059, 34390367
Primary Ovarian Insufficiency	Associate	22884017
Prodromal Symptoms	Stimulate	28791816
Prostate cancer familial	Associate	29095436
Prostate Cancer Hereditary 7	Associate	24971714
Prostatic Hyperplasia	Stimulate	34975070
Prostatic Hyperplasia	Associate	37378942
Prostatic Neoplasms	Associate	10360641, 10391095, 14523021, 15240830, 15477368, 1615580, 17200141, 17259348, 17712489, 17975021, 18561328, 19099590, 19123467, 19811499, 19934328 View all (25 more)
Prostatic Neoplasms	Stimulate	19099590
Prostatic Neoplasms Castration Resistant	Associate	35706368, 35782093
Prostatitis	Associate	12137562, 12900420, 18344492, 21270144, 22774984, 26181434, 31216740, 31415412, 33037017, 35422809
Prosthesis Failure	Associate	11518271
Protein Deficiency	Associate	24119107
Protein Energy Malnutrition	Associate	38017491
Proteinuria	Stimulate	14613268
Proteinuria	Associate	16555943, 28963877, 8258957
Prurigo	Stimulate	36806647
Pruritus	Associate	33982552
Pseudomonas Infections	Stimulate	10704054
Psoriasis	Associate	10469306, 10844563, 11851889, 12746914, 16409917, 16567387, 16831294, 1702929, 17530646, 17637826, 17928893, 18385757, 18669614, 19895991, 2002254 View all (45 more)
Psoriasis	Stimulate	17053845, 21681565, 24587411, 28045034, 34691360, 35848967
Psoriasis	Inhibit	26559252, 34001566
Psychological Trauma	Associate	29301248
Psychotic Disorders	Associate	24743863
Pterygium	Associate	28465659
Puberty Precocious	Associate	20389100
Pulmonary Arterial Hypertension	Associate	12376215, 21905008, 33531453, 37516840
Pulmonary Arterial Hypertension	Stimulate	20808962, 34238983
Pulmonary Disease Chronic Obstructive	Associate	10706492, 12537602, 12765422, 15544629, 15817713, 16867312, 16971410, 17631613, 18256059, 19480658, 20075389, 21691053, 21840694, 21985478, 22183488 View all (35 more)
Pulmonary Disease Chronic Obstructive	Stimulate	15337792, 16029496, 16135718, 17626109, 18202163, 20351031, 20500811, 20529083, 20856828, 26809128, 27199554, 27274225, 27524865, 27883019, 30655663, 33590951, 34007171, 35553638 View all (3 more)
Pulmonary edema of mountaineers	Associate	24465776
Pulmonary edema of mountaineers	Stimulate	34483727
Pulmonary Embolism	Associate	25434468, 33969714
Pulmonary Embolism	Stimulate	26667361, 35395844
Pulmonary Embolism	Inhibit	35572511
Pulmonary Fibrosis	Associate	20507572, 33832291, 34775492, 37898439
Pulpitis	Associate	33777260
Purpura Thrombocytopenic Idiopathic	Associate	11380443, 21591983, 21756542, 26076780, 28834165, 30021206, 31014934, 32563217, 36802017
Purpura Thrombocytopenic Idiopathic	Stimulate	27554456
Pyoderma Gangrenosum	Associate	20636397, 22161697, 25501066
Pyoderma Gangrenosum	Stimulate	21658319
Pyogenic arthritis pyoderma gangrenosum and acne	Associate	22161697
Pyropoikilocytosis Hereditary	Inhibit	7514902
Pyruvate Carboxylase Deficiency Disease	Stimulate	34571963
Pyruvate Carboxylase Deficiency Disease	Associate	36614201, 39518968
Q Fever	Associate	10931145, 31001808, 9933430
Q Fever	Stimulate	8613372
Radiation Pneumonitis	Associate	22541966
Raynaud Disease	Associate	22057071
Rectal Fistula	Associate	27402195
Rectal Neoplasms	Associate	26559268, 28575042
Rectovaginal Fistula	Stimulate	24453419
red meat allergy	Stimulate	33804792
Relapsing Fever	Stimulate	10625630, 10948181
Renal Insufficiency	Associate	15461705, 17428349, 18287021, 19860911, 26673143, 29305046, 33960101, 35347442, 37628639
Renal Insufficiency	Stimulate	18303205
Renal Insufficiency	Inhibit	36713400
Renal Insufficiency Chronic	Inhibit	16738534, 30280599
Renal Insufficiency Chronic	Associate	17428349, 23634661, 31687048, 36591354, 38017491, 40147025
Renal Insufficiency Chronic	Stimulate	18547996, 24111715, 25585822, 27992360, 32046176, 34359843, 40184113
Reperfusion Injury	Stimulate	20348235, 29542225
Reperfusion Injury	Associate	36856879
Reproductive Tract Infections	Associate	10329893, 21970639, 23555586, 33436768
Respiratory Distress Syndrome	Associate	11687457, 18490736, 21784970, 28298812, 31261506, 32720541
Respiratory Distress Syndrome	Stimulate	23883784, 31261506, 33845874
Respiratory Distress Syndrome	Inhibit	34944055
Respiratory Hypersensitivity	Stimulate	21784969
Respiratory Sounds	Associate	16204594, 16456144, 24465030, 27411394, 31901157
Respiratory Syncytial Virus Infections	Inhibit	20946625
Respiratory System Abnormalities	Associate	25955845, 34664888
Respiratory Tract Diseases	Associate	21357384, 21437888, 29172674, 35456412, 37958799, 38179046, 7813103
Respiratory Tract Infections	Associate	20627090, 27508393, 34987646, 38084427, 7670115
Retinal Detachment	Inhibit	34794403
Retinal Diseases	Associate	22266116, 25073020, 25086184
Retinal Diseases	Stimulate	25675437, 37924741
Retinal Perforations	Stimulate	19255163
Retinal Perforations	Inhibit	33430811
Retinal Vein Occlusion	Associate	31814701, 35370941, 36180575
Retinitis	Associate	12000736, 23592910, 25617622, 26015769
Retinitis Pigmentosa	Stimulate	37656622, 39472110
Retinoblastoma	Associate	15133451
Retinopathy of Prematurity	Associate	40084286
Retinoschisis	Associate	33601057
Retroperitoneal Fibrosis	Associate	16463424
Reye Syndrome	Associate	1847937
Rhabdoid Tumor	Associate	11267936
Rhabdomyosarcoma	Associate	23191987, 23797008, 24190483
Rheumatic Diseases	Associate	19040616, 23281897
Rheumatic Fever	Associate	22004920, 35979368
Rheumatic Fever	Inhibit	40226625
Rheumatic Heart Disease	Associate	15509528
Rheumatoid Arthritis Systemic Juvenile	Associate	10616003
Rheumatoid Nodule	Associate	12571841
Rheumatoid Vasculitis	Associate	9059140
Rhinitis	Stimulate	18201469
Rhinitis Allergic	Associate	21313996, 23472126, 24654309, 34477124, 37430199
Rhinitis Allergic	Stimulate	31185305, 38022554
Rhinitis Allergic Seasonal	Stimulate	18201469
Ring Chromosome 20 Syndrome	Stimulate	14982858, 28578351, 32417847, 37506161
Ring Chromosome 20 Syndrome	Associate	33191336
Rotator Cuff Injuries	Associate	11565192
Rotator Cuff Injuries	Stimulate	33407301
Rubella	Associate	20668555
Salivary Gland Neoplasms	Associate	16900776
Salmonella Infections	Associate	36311708
Salpingitis	Stimulate	31088412
Sarcoidosis	Associate	10400819, 11091281, 11411907, 11641969, 11817671, 12449172, 18451575, 18654018, 19225544, 21508170, 22195005, 22759465, 23745338, 24558177, 25866780 View all (5 more)
Sarcoidosis	Stimulate	16889950, 20851927, 27929051
Sarcoidosis Pulmonary	Associate	10400819, 26797030
Sarcoma	Associate	18065405, 2602359, 35069780, 8595164
Sarcoma	Inhibit	22719951, 36005179
Sarcoma Ewing	Associate	15581626, 16857678, 9201246
Sarcoma Ewing	Stimulate	34440851
Sarcoma Kaposi	Associate	34941134, 8669484
Sarcoma Myeloid	Associate	37530244
Sarcoma Synovial	Associate	24373201
Sarcoma Synovial	Stimulate	38217541
Sarcopenia	Associate	24285913, 40162588
Schistosomiasis	Associate	36820674
Schizophrenia	Associate	15340354, 24743863, 25433960, 27169466, 28049760, 28117656, 30254506, 30627222, 31954374, 36462601
Schizophrenia	Inhibit	20132993, 30630651
Schizophrenia	Stimulate	22832610, 37075652
Schizophrenia Paranoid	Associate	30627222
Schizophrenia Spectrum and Other Psychotic Disorders	Associate	15340354
Sciatic Neuropathy	Associate	16142759, 35356751
Scleritis	Associate	33287909, 37063831
Scleroderma Localized	Associate	38324287
Scleroderma Systemic	Associate	11710721, 14872499, 15642145, 1569319, 21905008, 33922041, 9540985
Scleroderma Systemic	Stimulate	38051374
Scrub Typhus	Associate	27463223
Scrub Typhus	Inhibit	34276693
Seizures	Associate	29729582, 30700814, 35598439
Seizures Febrile	Stimulate	29729582, 34449141, 38218765
Seminoma	Associate	37242266
Sepsis	Associate	10072898, 10450735, 10455128, 10477399, 12414751, 16444434, 17210974, 18088351, 18568240, 18949559, 2164042, 22842942, 23029405, 23796916, 23825193 View all (12 more)
Sepsis	Inhibit	22187279, 30666251, 31478785
Sepsis	Stimulate	31415369, 32496420, 9626052
Serum Sickness	Associate	29142473
Serum Sickness	Inhibit	34299123
Severe Acute Respiratory Syndrome	Associate	16124062, 18312678, 19158276, 25411910, 31257148
Severe Acute Respiratory Syndrome	Stimulate	32217835, 36949406, 37261339
Severe combined immunodeficiency due to adenosine deaminase deficiency	Associate	29333082, 34946883
Severe combined immunodeficiency due to adenosine deaminase deficiency	Stimulate	7511077
Severe Dengue	Associate	25589894, 31568656
Severe Dengue	Stimulate	37696512
Severe Fever with Thrombocytopenia Syndrome	Associate	29939989
Sexual Dysfunction Physiological	Associate	2789293
Sezary Syndrome	Associate	15315967, 22417305
Shock	Associate	32171247
Shock Cardiogenic	Associate	11219189
Shock Septic	Associate	10551799, 11093140, 12823857, 1500203, 19091080, 1989598, 24091885, 26347487, 26843329, 32171247, 37359526, 7509363, 8632999, 9933633
Shock Septic	Inhibit	11219189
Shock Septic	Stimulate	34035116
Shoulder Injuries	Associate	25595362
Shoulder Pain	Inhibit	37864374
Siderosis	Associate	11389006
Signs and Symptoms Digestive	Associate	29434052
Silicosis	Associate	23122308
Sinusitis	Associate	19405090, 27508393
Sjogren's Syndrome	Associate	10943866, 14872501, 16507175, 20131250, 22157716, 27188286, 29504848, 34596026, 35432384, 35705251, 35860283, 38013284, 38171773, 38416549, 39819714, 40650157, 9867125 View all (2 more)
Sjogren's Syndrome	Stimulate	16802368, 17898882, 26904697, 31281310
Sjogren's Syndrome	Inhibit	27461134
Skin Abnormalities	Associate	19920355
Skin Diseases	Associate	12485445, 14962095, 1919049, 19479852, 21357384, 21437440, 23732752, 29143979, 32962477, 37207444
Skin Diseases	Inhibit	15963988
Skin Diseases	Stimulate	22673732
Skin Diseases Eczematous	Associate	29143979
Skin Manifestations	Associate	17828345, 19225544, 38490347
Skin Neoplasms	Associate	18025480, 23429285
Sleep Apnea Obstructive	Associate	16204600, 19022640, 19218687, 26125882, 31210414, 32028672, 32029067, 36127647, 38172514, 38385464, 39252231
Sleep Apnea Obstructive	Stimulate	19581829, 20846669, 35652886
Sleep Apnea Obstructive	Inhibit	37217113
Sleep Deprivation	Stimulate	25373853, 25451613, 33146568, 38084427, 7662972, 8397114, 8980122, 9060702
Sleep Deprivation	Associate	25542735, 29029252, 33920292, 36982291
Sleep Initiation and Maintenance Disorders	Associate	25535857
Sleep Initiation and Maintenance Disorders	Inhibit	25749595
Sleep Wake Disorders	Associate	24587567
Small Cell Lung Carcinoma	Associate	34867972, 36879122
Small Fiber Neuropathy	Associate	36604634
Smoke Inhalation Injury	Associate	15188512, 27760580, 37084641
Smoke Inhalation Injury	Stimulate	26747782
smoker's inclusion bodies	Stimulate	37853419
Smoldering Multiple Myeloma	Inhibit	26668134
Smooth Muscle Tumor	Associate	31940218
Soft Tissue Injuries	Stimulate	10997557, 26173590
Soft Tissue Injuries	Associate	21465273
Somnambulism	Associate	25095746
Spherocytosis Type 1	Stimulate	23634661
Spherocytosis Type 1	Inhibit	34540188
Spinal Cord Injuries	Associate	27618987, 30700814, 32537668, 33451043, 33956875
Splenomegaly	Associate	21802960
Spondylarthritis	Associate	16947381, 19877080
Spondylarthritis	Inhibit	19333931
Spondylarthropathies	Associate	11212159, 15457463, 15986373
Spondylitis	Associate	37371064
Spondylitis Ankylosing	Associate	11114280, 17472990, 19318316, 23062122, 26125893, 26823867, 29546695, 29579081, 29744553, 29849482, 30075559, 30208882, 31195969, 33268443, 33622154 View all (6 more)
Spondylitis Ankylosing	Stimulate	34497300
Squamous Cell Carcinoma of Head and Neck	Associate	10543258, 11044363, 12771142, 16006770, 16376337, 18547033, 19789307, 20693797, 21788151, 21933882, 21990224, 22728043, 23313255, 23870134, 24278120 View all (15 more)
Squamous Cell Carcinoma of Head and Neck	Inhibit	20084448
Staphylococcal Infections	Stimulate	26225421
Staphylococcal Infections	Associate	33256638
Starvation	Associate	25879517
Status Asthmaticus	Associate	10456966, 15976383, 18390475, 19054597, 22268118, 22773691, 23527710, 23600543, 26722602, 30335498, 34621380, 9179403
Status Asthmaticus	Inhibit	22236730
Status Epilepticus	Stimulate	36802956
Stenotrophomonas maltophilia bacteremia	Associate	19608588
Stevens Johnson Syndrome	Associate	22992806, 36581093
Stevens Johnson Syndrome	Stimulate	28011147
Still's Disease Adult Onset	Associate	15184196, 27537874, 30687316, 34127696
Still's Disease Adult Onset	Stimulate	30616678
Stomach Diseases	Associate	11533078, 17562763, 22714811, 26504356, 32592356, 34104107
Stomach Neoplasms	Associate	1331059, 14695763, 15112338, 16769709, 19615068, 19924065, 2108945, 22351606, 22471589, 22714811, 23072573, 23326309, 23828749, 25548484, 26069103 View all (25 more)
Stomach Neoplasms	Stimulate	23117246, 26088449, 26219901, 28851954, 34773930
Stomach Neoplasms	Inhibit	37047540
Stomatitis	Associate	28401452, 31076897
Stomatitis Aphthous	Associate	21805152, 39343890
Stress Disorders Post Traumatic	Associate	29791872, 35312143
Stress Disorders Post Traumatic	Stimulate	30777365
Stroke	Associate	11553004, 14615367, 21455632, 21891866, 32503645, 36315566, 36911716, 37490433, 37794467
Stroke	Stimulate	20090932, 21298033, 24167359, 34201498, 39394477, 9013604
Stroke	Inhibit	36941081
Subarachnoid Hemorrhage	Associate	20534169
Substance Abuse Intravenous	Stimulate	19347588
Substance Related Disorders	Stimulate	21148804
Sunburn	Stimulate	28576736
Superinfection	Associate	15941417
Surgical Wound Infection	Associate	17592300
Sutton disease 2	Stimulate	34972503
Sweet Syndrome	Stimulate	20636397, 28609645
Syndrome	Associate	10192453, 23028541
Synovial Cyst	Associate	10513808, 10913062, 32159845, 9042434
Synovitis	Associate	11212159, 22614743, 24349530, 26792343, 28708839, 32409720, 9358757
Synovitis	Inhibit	19333931
Synovitis Pigmented Villonodular	Associate	15297283, 32929367
Syphilis	Associate	31358689, 32532356
Systemic Inflammatory Response Syndrome	Associate	16276011, 20627090, 22487520, 29131009
Systemic Inflammatory Response Syndrome	Stimulate	20634913, 32329660
Systemic Vasculitis	Associate	14703611, 16514436
Systemic Vasculitis	Stimulate	1696867
Tachycardia Atrioventricular Nodal Reentry	Associate	33342810
Takayasu Arteritis	Associate	15498051, 23703343, 30595251
Tang Hsi Ryu syndrome	Stimulate	33196557
Taste Disorders	Associate	28717082
Taurodontism	Associate	30078208
Temporomandibular Joint Dysfunction Syndrome	Associate	33101543
Temporomandibular Joint Dysfunction Syndrome	Stimulate	36445911
Tendinopathy	Associate	21669872, 29385715
Tertiary Lymphoid Structures	Associate	20978325
Thalassemia	Associate	12111782, 26376749
Thalassemia	Inhibit	36323999
Thoracic Diseases	Stimulate	38173720
Thoracic Injuries	Inhibit	31238711
Thrombocythemia Essential	Associate	24463275, 33599741
Thrombocytopenia	Associate	25589894, 28865603, 36802017
Thrombophilia	Associate	15497022, 9633890
Thrombophilia	Stimulate	35180460
Thrombosis	Associate	10393703, 20536609, 35180460, 35297992, 38608731, 40513998
Thymoma	Associate	33704915
Thyroid Cancer Papillary	Associate	1320006, 37898675
Thyroid Cancer Papillary	Stimulate	32050977
Thyroid Carcinoma Anaplastic	Associate	8697623
Thyroid Neoplasms	Associate	1375873, 19190106, 26577851, 37506147
Thyroid Neoplasms	Stimulate	29953504
Thyroiditis	Associate	10464273
Thyroiditis	Inhibit	31350776, 8697623
Thyroiditis Autoimmune	Associate	19250279, 25127106, 29526119, 32604892, 36387897
Thyroiditis Autoimmune	Stimulate	36362417
Tight skin contracture syndrome lethal	Associate	11173656
Tinnitus	Associate	29676293, 36401375
Tn Syndrome	Associate	35628426
Tonsillar Neoplasms	Associate	25826493
Tooth Erosion	Associate	12746914, 16572445, 22039170, 32855274, 33855071
Tooth Resorption	Stimulate	29521042
Tourette Syndrome	Inhibit	28067847
Toxoplasmosis	Associate	32126572
Toxoplasmosis Ocular	Associate	29426041
Trachoma	Stimulate	15557667
Trachoma	Associate	9038309
Transposition of Great Vessels	Associate	35590253
Trigeminal Neuralgia	Stimulate	34067581
Trigger Finger Disorder	Stimulate	37853419
Triple Negative Breast Neoplasms	Associate	23729230, 25762639, 26792858, 27476169, 27656833, 31105691, 31665136, 33599741, 33707603, 33918859, 34072893, 34197030, 34475205, 35228654, 35260587 View all (4 more)
Triple Negative Breast Neoplasms	Stimulate	34848446, 35964108
Trisomy	Stimulate	12149200
Tuberculosis	Associate	10691916, 12751024, 15722350, 16556259, 16638580, 18160618, 19439012, 20007930, 20537163, 23343370, 23703343, 23800941, 26611774, 29888256, 30481307, 33904770, 35305574, 35839170, 7683696 View all (4 more)
Tuberculosis	Stimulate	15908253, 15932510, 28329119, 31599428, 32053511, 32117257, 33287713, 8403517, 8565282
Tuberculosis	Inhibit	36619740, 38179046
Tuberculosis Extrapulmonary	Associate	36630812
Tuberculosis Meningeal	Stimulate	10691916, 10970348, 35552657, 8132351
Tuberculosis Meningeal	Associate	22961735, 26567164, 26681217, 27861807, 29430075, 29778672, 36823694
Tuberculosis Meningeal	Inhibit	37376629
Tuberculosis Multidrug Resistant	Associate	31137684, 34424286
Tuberculosis Osteoarticular	Associate	27813605, 34540202
Tuberculosis Osteoarticular	Stimulate	28543876
Tuberculosis Pleural	Associate	19156215
Tuberculosis Pulmonary	Associate	16840026, 19370184, 23671613, 25528189, 26567164, 26840977, 27434276, 28333932, 29430075, 33202583, 34275341, 36630812, 39198650, 8403517
Tuberculosis Pulmonary	Inhibit	19703020, 20007364, 29888256
Tuberculosis Pulmonary	Stimulate	31226436
Tuberculosis Spinal	Associate	29298876, 29795056
Ulcer	Associate	22688339, 26504356
Uremia	Associate	34858433
Urethral Neoplasms	Associate	29951534, 35003325
Urinary Bladder Diseases	Associate	29920227
Urinary Bladder Neck Obstruction	Associate	29920227
Urinary Bladder Neoplasms	Inhibit	10233685
Urinary Bladder Neoplasms	Associate	12966432, 1450063, 17267001, 27034531, 29517678, 29854840, 33924332, 40312703, 40777041
Urologic Diseases	Associate	21191629
Uterine Cervical Diseases	Associate	26241630
Uterine Cervical Neoplasms	Associate	11278357, 11739693, 12657115, 16438713, 17177206, 17452777, 19369479, 19823053, 21119362, 22592655, 23028877, 23824834, 24197984, 24885472, 25113639 View all (13 more)
Uterine Cervical Neoplasms	Stimulate	19823053
Uterine Cervicitis	Associate	23936772, 24197984, 30547901, 34498478, 35463689, 8098584
Uterine Diseases	Associate	29664552, 34010983, 35279667
Uveal melanoma	Associate	24124368
Uveitis	Associate	14977779, 15196263, 21957872, 27028890, 30779760, 37924741
Uveitis	Stimulate	25354724, 35061677
Uveitis Intermediate	Stimulate	14977779
Uveitis Intermediate	Associate	23378732
Vaginosis Bacterial	Stimulate	17532476, 35017496
Vaginosis Bacterial	Associate	20965572, 26844497
Varicella Zoster Virus Infection	Inhibit	23884823
Varicocele	Associate	36372090
Varicose Ulcer	Associate	10514213
Vascular Calcification	Associate	36930472
Vascular Diseases	Stimulate	11278252, 24486907, 29682517, 29956764, 31744135, 33236147, 33381228, 39578766
Vascular Diseases	Associate	15102770, 21658307, 21754991, 24349153, 25963668, 27251500, 30526655, 32896251, 33196557, 34858433, 38195507
Vascular Remodeling	Associate	26667361
Vascular System Injuries	Associate	10948142, 21905018, 28848152
Vascular System Injuries	Stimulate	12855710, 27124409
Vasculitis	Associate	10759767, 15479908, 17446240, 31945408, 33287909, 33299497
Vasculitis	Stimulate	22152684
Venous Insufficiency	Associate	29439934
Venous Thromboembolism	Associate	23852308, 32805626, 34077299
Venous Thrombosis	Associate	35808901
Ventricular Dysfunction	Associate	9091515
Ventricular Remodeling	Associate	15388510, 36012347
VEXAS syndrome	Associate	37586319
Viremia	Associate	29768624, 31441603
Virus Diseases	Associate	10542136, 10688670, 11306566, 16081933, 18617992, 19640730, 24197984, 25559996, 25781011, 27644640, 27997912, 34233673, 38460895, 7509363, 9060702, 9442069 View all (1 more)
Virus Diseases	Stimulate	15218506, 2537976, 32603902, 34076157
Visceral myopathy familial external ophthalmoplegia	Associate	23451225
Vision Disorders	Associate	34424286
Vitamin D Deficiency	Stimulate	25380286
Vitiligo	Stimulate	23284977, 26370050, 40723924
Vitiligo	Associate	23884763, 24312346, 32616337, 32705792, 33370782, 9077486
Vitreoretinopathy Proliferative	Associate	31069271
Vocal Cord Paralysis	Associate	20715091
Vomiting	Stimulate	10498591
von Hippel Lindau Disease	Associate	11171960
Vulvar Neoplasms	Associate	23824834, 9067409
Waldenstrom Macroglobulinemia	Associate	33690107
Weight Loss	Inhibit	12055326, 18356846, 21147860, 30385096, 7738178
Weight Loss	Associate	17674351, 19584886, 27897403, 34502316
Weill Marchesani Syndrome	Stimulate	15223607
Werner Syndrome	Stimulate	26037922
Whooping Cough	Stimulate	24176499
Whooping Cough	Associate	25787136
Wilms Tumor	Inhibit	34519584
Wolfram Syndrome	Associate	33693650
Wounds and Injuries	Associate	11112697, 15699425, 24034344, 28316377, 33446687, 8889469
Wounds and Injuries	Stimulate	24365862, 30581533, 31791242, 36119928, 9383488
Wounds and Injuries	Inhibit	31085907
Wounds Nonpenetrating	Associate	12414751
Xanthomatosis	Stimulate	16083882, 24428816
Xeroderma Pigmentosum	Associate	10998144
Xerostomia	Associate	38171773
Yellow Fever	Associate	16278000
Yellow Fever	Stimulate	19906894
Zika Virus Infection	Associate	33672623
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	12812920

TNF (tumor necrosis factor)