Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54106
Gene name Gene Name - the full gene name approved by the HGNC.	Toll like receptor 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TLR9
Synonyms (NCBI Gene) Gene synonyms aliases	CD289
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the Toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and fun

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736441	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT2349590	hsa-miR-125a-3p	CLIP-seq
MIRT2349591	hsa-miR-3194-3p	CLIP-seq
MIRT2349592	hsa-miR-3934	CLIP-seq
MIRT2349593	hsa-miR-4710	CLIP-seq
MIRT2349594	hsa-miR-592	CLIP-seq
MIRT2349595	hsa-miR-597	CLIP-seq
MIRT2349596	hsa-miR-764	CLIP-seq

Transcription factors

Show/Hide all(9)

Transcription factor	Regulation	Reference
CEBPA	Unknown	15294971
CREB1	Unknown	15294971
ELF1	Unknown	15294971
ELK1	Unknown	15294971
ETS2	Unknown	15294971
HDAC3	Unknown	25194054
NFKB1	Unknown	25194054
PTMA	Repression	21176371;21575365
RELA	Unknown	25194054

Show/Hide all(73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002224	Process	Toll-like receptor signaling pathway	IBA	21873635
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002237	Process	Response to molecule of bacterial origin	TAS	15356140
GO:0002639	Process	Positive regulation of immunoglobulin production	IDA	23857366
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IPI	12925853
GO:0005576	Component	Extracellular region	NAS	11130078
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005764	Component	Lysosome	ISS
GO:0005768	Component	Endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	19740627
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA	21873635
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0007252	Process	I-kappaB phosphorylation	IDA	19740627
GO:0010008	Component	Endosome membrane	TAS
GO:0010628	Process	Positive regulation of gene expression	IDA	24409285
GO:0016021	Component	Integral component of membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	17128265
GO:0016324	Component	Apical plasma membrane	IDA	17128265
GO:0030277	Process	Maintenance of gastrointestinal epithelium	ISS
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	23857366
GO:0032009	Component	Early phagosome	ISS
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	17128265
GO:0032640	Process	Tumor necrosis factor production	IBA	21873635
GO:0032640	Process	Tumor necrosis factor production	IDA	23826189
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032717	Process	Negative regulation of interleukin-8 production	IDA	17128265
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	24409285
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	16286015
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	16286015
GO:0032728	Process	Positive regulation of interferon-beta production	ISS
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	16286015
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032741	Process	Positive regulation of interleukin-18 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA	21873635
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19740627, 24409285
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17128265, 19740627, 24409285
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IDA	17128265
GO:0034123	Process	Positive regulation of toll-like receptor signaling pathway	IDA	17128265
GO:0034162	Process	Toll-like receptor 9 signaling pathway	TAS
GO:0034163	Process	Regulation of toll-like receptor 9 signaling pathway	IDA	23857366
GO:0035197	Function	SiRNA binding	IMP	15723075
GO:0036019	Component	Endolysosome	ISS
GO:0036020	Component	Endolysosome membrane	TAS
GO:0038187	Function	Pattern recognition receptor activity	IBA	21873635
GO:0042742	Process	Defense response to bacterium	NAS	11130078
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	17128265
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23857366
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	17128265
GO:0045087	Process	Innate immune response	TAS	15356140
GO:0045322	Function	Unmethylated CpG binding	ISS
GO:0045577	Process	Regulation of B cell differentiation	IDA	23857366
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IC	17128265
GO:0050729	Process	Positive regulation of inflammatory response	IC	19740627
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	22427638
GO:0050871	Process	Positive regulation of B cell activation	IDA	23857366
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	17128265
GO:0051607	Process	Defense response to virus	IBA	21873635
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	ISS
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	19740627
GO:1901895	Process	Negative regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	24610369

MIM	HGNC	e!Ensembl
605474	15633	ENSG00000239732

Protein

UniProt ID

Q9NR96

Protein name

Toll-like receptor 9 (CD antigen CD289)

Protein function

Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by

PDB

8AR3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	50 → 98	Leucine rich repeat	Repeat
PF13855	LRR_8	290 → 345	Leucine rich repeat	Repeat
PF18837	LRR_12	393 → 422	Leucine-rich repeat	Repeat
PF13855	LRR_8	701 → 762	Leucine rich repeat	Repeat
PF01582	TIR	870 → 1030	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver.

Sequence

MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE

Sequence length

1032

Interactions

View interactions

TLR9 (toll like receptor 9)