TLR9 (toll like receptor 9)

Gene Gene information from NCBI Gene database.
Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID 54106
Gene name Toll like receptor 9
Gene symbol TLR9
Synonyms (NCBI Gene)
CD289
Chromosome 3
Chromosome location 3p21.2
Summary The protein encoded by this gene is a member of the Toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and fun
miRNA miRNA information provided by mirtarbase database.
8
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (8)
miRTarBase ID miRNA Experiments Reference
MIRT736441 hsa-miR-491-3p qRT-PCRFlow cytometry 33679688
MIRT2349590 hsa-miR-125a-3p CLIP-seq
MIRT2349591 hsa-miR-3194-3p CLIP-seq
MIRT2349592 hsa-miR-3934 CLIP-seq
MIRT2349593 hsa-miR-4710 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
9
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (9)
Transcription factor Regulation Reference
CEBPA Unknown 15294971
CREB1 Unknown 15294971
ELF1 Unknown 15294971
ELK1 Unknown 15294971
ETS2 Unknown 15294971
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
115
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (115)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0001774 Process Microglial cell activation IEA
GO:0001819 Process Positive regulation of cytokine production IEA
GO:0002218 Process Activation of innate immune response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs Transcription factors Other IDs Associated diseases
MIM HGNC e!Ensembl
605474 15633 ENSG00000239732
Protein Protein information from UniProt database.
Gene SNPs Transcription factors Other IDs Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NR96
Protein name Toll-like receptor 9 (CD antigen CD289)
Protein function Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by
PDB 8AR3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 50 → 98 Leucine rich repeat Repeat
PF13855 LRR_8 290 → 345 Leucine rich repeat Repeat
PF18837 LRR_12 393 → 422 Leucine-rich repeat Repeat
PF13855 LRR_8 701 → 762 Leucine rich repeat Repeat
PF01582 TIR 870 → 1030 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver.
Sequence 
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
Sequence length 1032
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Esophageal atresia/tracheoesophageal fistula Likely pathogenic rs780099835 RCV001172304
Show/Hide Text Mining Associations (300)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 35905120
AA amyloidosis Inhibit 23957925
Achondroplasia and Swiss type agammaglobulinemia Associate 17932028
Acidosis Renal Tubular Associate 31002145
Acquired Immunodeficiency Syndrome Associate 33777838, 36926756
Acute Disease Stimulate 20416452
Acute Kidney Injury Associate 25293716
Adenocarcinoma of Lung Associate 37746997
Alcoholism Associate 34415075
Allergic Fungal Sinusitis Associate 25133733, 31238737