Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7099
Gene name Gene Name - the full gene name approved by the HGNC.
Toll like receptor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TLR4
Synonyms (NCBI Gene) Gene synonyms aliases
ARMD10, CD284, TLR-4, TOLL
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q33.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003050 hsa-let-7i-5p Luciferase reporter assay, qRT-PCR, Western blot 17660297
MIRT003050 hsa-let-7i-5p Luciferase reporter assay, qRT-PCR, Western blot 17660297
MIRT006530 hsa-miR-146a-5p ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 21329689
MIRT006530 hsa-miR-146a-5p ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 21329689
MIRT006530 hsa-miR-146a-5p ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 21329689
Transcription factors
Transcription factor Regulation Reference
IRF3 Unknown 22208359
IRF8 Unknown 10734131
SPI1 Activation 16785240;20956019
SPI1 Unknown 10734131
STAT6 Repression 16433852
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001530 Function Lipopolysaccharide binding IBA
GO:0001530 Function Lipopolysaccharide binding IMP 16514062
GO:0001530 Function Lipopolysaccharide binding NAS 10835634
GO:0001540 Function Amyloid-beta binding IC 20037584
GO:0001726 Component Ruffle IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603030 11850 ENSG00000136869
Protein
UniProt ID O00206
Protein name Toll-like receptor 4 (hToll) (CD antigen CD284)
Protein function Transmembrane receptor that functions as a pattern recognition receptor recognizing pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to induce innate immune responses via downstream signaling pathways (PubMed:10835634, PubMed
PDB 2Z62 , 2Z63 , 2Z65 , 2Z66 , 3FXI , 3UL7 , 3UL8 , 3UL9 , 3ULA , 4G8A , 5NAM , 5NAO , 8WO1 , 8WTA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 55 114 Leucine rich repeat Repeat
PF13855 LRR_8 78 138 Leucine rich repeat Repeat
PF13855 LRR_8 126 187 Leucine rich repeat Repeat
PF13855 LRR_8 150 207 Leucine rich repeat Repeat
PF13855 LRR_8 447 508 Leucine rich repeat Repeat
PF13855 LRR_8 485 532 Leucine rich repeat Repeat
PF13855 LRR_8 496 556 Leucine rich repeat Repeat
PF01582 TIR 674 839 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in placenta, spleen and peripheral blood leukocytes (PubMed:9237759, PubMed:9435236). Detected in monocytes, macrophages, dendritic cells and several types of T-cells (PubMed:27022195, PubMed:9237759). Expressed in pan
Sequence
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSF
PELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKI
QSIYCTDLRVLHQMPLLNLS
LDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQ
ENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHI
MTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
Sequence length 839
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Angioedema Hereditary angioedema with normal C1Inh N/A N/A ClinVar
Anxiety Disorder Anxiety N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Hypertension Ischemic stroke in hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Injuries Stimulate 37876569
Abnormalities Drug Induced Associate 25120286
Absent corpus callosum cataract immunodeficiency Associate 34689707
Acanthamoeba Keratitis Associate 33755043
Acne Vulgaris Associate 29927962, 31662521
Acquired Immunodeficiency Syndrome Associate 33777838
Acute Aortic Syndrome Stimulate 30497388
Acute Aortic Syndrome Associate 33426065
Acute Coronary Syndrome Stimulate 18373609, 19556696, 25179298
Acute Coronary Syndrome Associate 20447947, 28407320