Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
114609
Gene name Gene Name - the full gene name approved by the HGNC.
TIR domain containing adaptor protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TIRAP
Synonyms (NCBI Gene) Gene synonyms aliases
BACTS1, Mal, MyD88-2, wyatt
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleuk
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004748 hsa-miR-145-5p Immunoprecipitaion, Western blot, Communoprecipitaion 19898489
MIRT674506 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT674505 hsa-miR-764 HITS-CLIP 23824327
MIRT674504 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT674503 hsa-miR-4635 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0002755 Process MyD88-dependent toll-like receptor signaling pathway TAS 19509286
GO:0005080 Function Protein kinase C binding IPI 17161867
GO:0005515 Function Protein binding IPI 11544529, 17258210, 17360653, 17583698, 19509286, 19574958, 19948740, 21334391, 21829704, 21903422, 22155231, 24275656, 33961781
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606252 17192 ENSG00000150455
Protein
UniProt ID P58753
Protein name Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein) (MyD88-2)
Protein function Adapter involved in TLR2, TLR4 and RAGE signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response
PDB 2NDH , 2Y92 , 3UB2 , 3UB3 , 3UB4 , 4FZ5 , 4LQD , 5T7Q , 5UZB , 8JZM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13676 TIR_2 88 211 TIR domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain.
Sequence
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKE
AVMRYLQTLS
Sequence length 221
Interactions View interactions
<