Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7046
Gene name	Transforming growth factor beta receptor 1
Gene symbol	TGFBR1
Synonyms (NCBI Gene)	AAT5ACVRLK4ALK-5ALK5ESS1LDS1LDS1ALDS2AMSSESKR4TBR-iTBRITGFR-1tbetaR-I
Chromosome	9
Chromosome location	9q22.33
Summary	The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutation

Show/Hide all (50)

SNP ID	Visualize variation	Clinical significance	Consequence
rs11466445	GCGGCGGCGGCGGCG>-,GCG,GCGGCG,GCGGCGGCG,GCGGCGGCGGCG,GCGGCGGCGGCGGCGGCG,GCGGCGGCGGCGGCGGCGGCG,GCGGCGGCGGCGGCGGCGGCGGCG,GCGGCGGCGGCGGCGGCGGCGGCGGCG	Benign, conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign, benign-likely-benign	Intron variant, inframe deletion, inframe insertion, genic upstream transcript variant, coding sequence variant
rs111426349	C>A,G,T	Pathogenic, uncertain-significance	Coding sequence variant, synonymous variant, missense variant
rs111854391	C>A,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant, stop gained
rs113605875	G>A,C,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121918710	T>G	Pathogenic	Coding sequence variant, missense variant
rs121918711	A>G	Pathogenic	Coding sequence variant, missense variant
rs121918712	C>T	Pathogenic	Coding sequence variant, missense variant
rs121918713	G>T	Pathogenic	Coding sequence variant, missense variant, intron variant
rs145033378	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, 5 prime UTR variant, coding sequence variant
rs148176750	A>G	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, intron variant, coding sequence variant
rs190878719	G>A	Conflicting-interpretations-of-pathogenicity, benign-likely-benign, likely-benign	Coding sequence variant, synonymous variant, intron variant
rs387906696	A>G	Uncertain-significance, risk-factor	Missense variant, 5 prime UTR variant, coding sequence variant
rs387906697	C>T	Risk-factor, pathogenic	Stop gained, coding sequence variant
rs587776865	G>C	Uncertain-significance, risk-factor	Missense variant, 5 prime UTR variant, coding sequence variant
rs587776866	A>C	Risk-factor	Splice acceptor variant
rs727503470	G>A,T	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs730880223	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs759805984	T>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs760079636	G>A	Likely-pathogenic, pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs767589799	G>T	Likely-pathogenic	Coding sequence variant, missense variant
rs772339721	A>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs863223811	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223812	C>T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs863223814	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223815	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223816	A>C,G	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs863223817	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs863223819	A>G	Pathogenic	Coding sequence variant, missense variant
rs863223822	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223829	AAG>-	Pathogenic	Coding sequence variant, inframe deletion
rs863223832	C>A,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs869025535	G>A	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs878854714	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Synonymous variant, coding sequence variant, genic upstream transcript variant, intron variant
rs886038919	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs886038954	->TG	Pathogenic	Coding sequence variant, frameshift variant
rs886039176	T>C,G	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1057524497	G>A,T	Pathogenic, uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, stop gained, missense variant
rs1060502040	C>T	Pathogenic	Coding sequence variant, intron variant, stop gained
rs1060502042	G>A	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs1131691342	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1554700603	->TGG	Pathogenic	Coding sequence variant, inframe insertion
rs1554700672	G>T	Pathogenic	Coding sequence variant, stop gained
rs1554701881	A>C,G	Likely-pathogenic	Splice acceptor variant
rs1554701911	G>T	Pathogenic	Coding sequence variant, missense variant
rs1554701914	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1554702262	G>A	Pathogenic	Splice donor variant
rs1554702463	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1564161224	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1588585506	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1588585570	C>T	Likely-pathogenic	Coding sequence variant, missense variant

1021

Show/Hide all (1021)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000687	hsa-let-7c-5p	qRT-PCRLuciferase reporter assayWestern blot	19841744
MIRT004650	hsa-miR-128-3p	Luciferase reporter assayWestern blot	20054641
MIRT003271	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT007379	hsa-miR-140-5p	Luciferase reporter assay	23401231
MIRT021634	hsa-miR-142-3p	Microarray	17612493
MIRT027382	hsa-miR-101-3p	Sequencing	20371350
MIRT027865	hsa-miR-98-5p	Microarray	19088304
MIRT032178	hsa-let-7d-5p	Sequencing	20371350
MIRT004650	hsa-miR-128-3p	CLASH	23622248
MIRT027382	hsa-miR-101-3p	ImmunofluorescenceqRT-PCR	24817606
MIRT053633	hsa-let-7f-5p	Microarray	22942087
MIRT053635	hsa-miR-130a-3p	Microarray	22942087
MIRT053663	hsa-miR-181a-5p	Microarray	22942087
MIRT053663	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	22714950
MIRT053663	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	22714950
MIRT054832	hsa-let-7b-5p	GFP reporter assayWestern blotELISA	24978044
MIRT437849	hsa-miR-376c-3p	Luciferase reporter assayqRT-PCRWestern blot	23424236
MIRT437849	hsa-miR-376c-3p	Luciferase reporter assayqRT-PCRWestern blot	23424236
MIRT437849	hsa-miR-376c-3p	Luciferase reporter assayqRT-PCRWestern blot	23424236
MIRT437849	hsa-miR-376c-3p	Luciferase reporter assayqRT-PCRWestern blot	23424236
MIRT438737	hsa-miR-135b-5p	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	24802670
MIRT438737	hsa-miR-135b-5p	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	24802670
MIRT021634	hsa-miR-142-3p	Luciferase reporter assayqRT-PCRWestern blot	24558198
MIRT021634	hsa-miR-142-3p	Luciferase reporter assayqRT-PCRWestern blot	24558198
MIRT438737	hsa-miR-135b-5p	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	24802670
MIRT438737	hsa-miR-135b-5p	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	24802670
MIRT021634	hsa-miR-142-3p	Luciferase reporter assayqRT-PCRWestern blot	24558198
MIRT021634	hsa-miR-142-3p	Luciferase reporter assayqRT-PCRWestern blot	24558198
MIRT698515	hsa-miR-379-5p	HITS-CLIP	23313552
MIRT698514	hsa-miR-3529-5p	HITS-CLIP	23313552
MIRT698513	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT698512	hsa-miR-4643	HITS-CLIP	23313552
MIRT372394	hsa-miR-3927-3p	HITS-CLIP	23313552
MIRT372395	hsa-miR-6831-5p	HITS-CLIP	23313552
MIRT698511	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT698510	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT698509	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT698508	hsa-miR-204-3p	HITS-CLIP	23313552
MIRT698507	hsa-miR-4646-5p	HITS-CLIP	23313552
MIRT173515	hsa-miR-4668-5p	HITS-CLIP	23313552
MIRT698506	hsa-miR-3153	HITS-CLIP	23313552
MIRT698505	hsa-miR-6733-5p	HITS-CLIP	23313552
MIRT698504	hsa-miR-6739-5p	HITS-CLIP	23313552
MIRT698503	hsa-miR-466	HITS-CLIP	23313552
MIRT106691	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT106693	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT698502	hsa-miR-6888-3p	HITS-CLIP	23313552
MIRT496744	hsa-miR-8063	PAR-CLIP	22291592
MIRT173481	hsa-miR-1283	PAR-CLIP	22291592
MIRT496743	hsa-miR-4480	PAR-CLIP	22291592
MIRT323791	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT323788	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT004650	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT323787	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466411	hsa-miR-3156-5p	PAR-CLIP	23592263
MIRT173532	hsa-miR-8083	PAR-CLIP	23592263
MIRT466410	hsa-miR-6887-3p	PAR-CLIP	23592263
MIRT466409	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT466408	hsa-miR-6826-3p	PAR-CLIP	23592263
MIRT323791	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT323788	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT004650	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT323787	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466411	hsa-miR-3156-5p	PAR-CLIP	23592263
MIRT173532	hsa-miR-8083	PAR-CLIP	23592263
MIRT466410	hsa-miR-6887-3p	PAR-CLIP	23592263
MIRT466409	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT466408	hsa-miR-6826-3p	PAR-CLIP	23592263
MIRT021634	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT021634	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT732226	hsa-miR-490-3p	Luciferase reporter assayWestern blot	26714817
MIRT732226	hsa-miR-490-3p	Luciferase reporter assayWestern blot	26714817
MIRT173470	hsa-miR-202-5p	Luciferase reporter assayWestern blot	28373289
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT021634	hsa-miR-142-3p	Western blot	28146434
MIRT733703	hsa-miR-26a-5p	ELISAImmunoprecipitaion (IP)Luciferase reporter assayWestern blotting	33857357
MIRT735954	hsa-miR-101-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCRELISA	32633566
MIRT736856	hsa-miR-92a-3p	Luciferase reporter assayWestern blottingFlow cytometry	31591389
MIRT737292	hsa-miR-876-5p	Luciferase reporter assayWestern blottingqRT-PCR	32724369
MIRT027382	hsa-miR-101-3p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)qRT-PCRFlow cytometry	31831099
MIRT737575	hsa-let-7b-3p	ImmunofluorescenceqRT-PCR	31614978
MIRT698515	hsa-miR-379-5p	HITS-CLIP	23313552
MIRT698514	hsa-miR-3529-5p	HITS-CLIP	23313552
MIRT698513	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT698512	hsa-miR-4643	HITS-CLIP	23313552
MIRT372394	hsa-miR-3927-3p	HITS-CLIP	23313552
MIRT372395	hsa-miR-6831-5p	HITS-CLIP	23313552
MIRT698511	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT698510	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT698509	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT698508	hsa-miR-204-3p	HITS-CLIP	23313552
MIRT698507	hsa-miR-4646-5p	HITS-CLIP	23313552
MIRT173515	hsa-miR-4668-5p	HITS-CLIP	23313552
MIRT698506	hsa-miR-3153	HITS-CLIP	23313552
MIRT698505	hsa-miR-6733-5p	HITS-CLIP	23313552
MIRT698504	hsa-miR-6739-5p	HITS-CLIP	23313552
MIRT698503	hsa-miR-466	HITS-CLIP	23313552
MIRT106691	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT106693	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT698502	hsa-miR-6888-3p	HITS-CLIP	23313552
MIRT496744	hsa-miR-8063	PAR-CLIP	22291592
MIRT173481	hsa-miR-1283	PAR-CLIP	22291592
MIRT496743	hsa-miR-4480	PAR-CLIP	22291592
MIRT323791	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT323788	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT004650	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT323787	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466411	hsa-miR-3156-5p	PAR-CLIP	23592263
MIRT173532	hsa-miR-8083	PAR-CLIP	23592263
MIRT466410	hsa-miR-6887-3p	PAR-CLIP	23592263
MIRT466409	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT466408	hsa-miR-6826-3p	PAR-CLIP	23592263
MIRT323791	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT323788	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT004650	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT323787	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466411	hsa-miR-3156-5p	PAR-CLIP	23592263
MIRT173532	hsa-miR-8083	PAR-CLIP	23592263
MIRT466410	hsa-miR-6887-3p	PAR-CLIP	23592263
MIRT466409	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT466408	hsa-miR-6826-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assayWestern blottingqRT-PCR	38825706
MIRT755812	mmu-let-7a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35386460
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT1421227	hsa-miR-1200	CLIP-seq
MIRT1421228	hsa-miR-1208	CLIP-seq
MIRT1421229	hsa-miR-1224-3p	CLIP-seq
MIRT1421230	hsa-miR-1236	CLIP-seq
MIRT1421231	hsa-miR-1245	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT1421233	hsa-miR-1260	CLIP-seq
MIRT1421234	hsa-miR-1260b	CLIP-seq
MIRT1421235	hsa-miR-1280	CLIP-seq
MIRT1421236	hsa-miR-1305	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT1421238	hsa-miR-141	CLIP-seq
MIRT1421239	hsa-miR-150	CLIP-seq
MIRT1421240	hsa-miR-151-3p	CLIP-seq
MIRT1421241	hsa-miR-181a	CLIP-seq
MIRT1421242	hsa-miR-181b	CLIP-seq
MIRT1421243	hsa-miR-181c	CLIP-seq
MIRT1421244	hsa-miR-181d	CLIP-seq
MIRT1421245	hsa-miR-188-3p	CLIP-seq
MIRT1421246	hsa-miR-193a-3p	CLIP-seq
MIRT1421247	hsa-miR-193b	CLIP-seq
MIRT1421248	hsa-miR-200a	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT1421250	hsa-miR-221	CLIP-seq
MIRT1421251	hsa-miR-222	CLIP-seq
MIRT1421252	hsa-miR-3064-3p	CLIP-seq
MIRT1421253	hsa-miR-3074-3p	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT1421255	hsa-miR-3128	CLIP-seq
MIRT1421256	hsa-miR-3140-3p	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421258	hsa-miR-3146	CLIP-seq
MIRT1421259	hsa-miR-3148	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT1421261	hsa-miR-3157-5p	CLIP-seq
MIRT1421262	hsa-miR-3160-5p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421264	hsa-miR-3174	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT1421266	hsa-miR-337-3p	CLIP-seq
MIRT1421267	hsa-miR-34b	CLIP-seq
MIRT1421268	hsa-miR-3545-5p	CLIP-seq
MIRT1421269	hsa-miR-3607-3p	CLIP-seq
MIRT1421270	hsa-miR-3614-5p	CLIP-seq
MIRT1421271	hsa-miR-3617	CLIP-seq
MIRT1421272	hsa-miR-3622a-3p	CLIP-seq
MIRT1421273	hsa-miR-3622b-3p	CLIP-seq
MIRT1421274	hsa-miR-3646	CLIP-seq
MIRT1421275	hsa-miR-3662	CLIP-seq
MIRT1421276	hsa-miR-3667-3p	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT1421278	hsa-miR-3682-3p	CLIP-seq
MIRT1421279	hsa-miR-3685	CLIP-seq
MIRT1421280	hsa-miR-3686	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT1421282	hsa-miR-376c	CLIP-seq
MIRT1421283	hsa-miR-380	CLIP-seq
MIRT1421284	hsa-miR-384	CLIP-seq
MIRT1421285	hsa-miR-3921	CLIP-seq
MIRT1421286	hsa-miR-3925-3p	CLIP-seq
MIRT1421287	hsa-miR-3973	CLIP-seq
MIRT1421288	hsa-miR-3976	CLIP-seq
MIRT1421289	hsa-miR-4251	CLIP-seq
MIRT1421290	hsa-miR-4252	CLIP-seq
MIRT1421291	hsa-miR-4261	CLIP-seq
MIRT1421292	hsa-miR-4262	CLIP-seq
MIRT1421293	hsa-miR-4280	CLIP-seq
MIRT1421294	hsa-miR-4291	CLIP-seq
MIRT1421295	hsa-miR-4297	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT1421297	hsa-miR-4326	CLIP-seq
MIRT1421298	hsa-miR-4329	CLIP-seq
MIRT1421299	hsa-miR-433	CLIP-seq
MIRT1421300	hsa-miR-4433	CLIP-seq
MIRT1421301	hsa-miR-4434	CLIP-seq
MIRT1421302	hsa-miR-4452	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT1421304	hsa-miR-4460	CLIP-seq
MIRT1421305	hsa-miR-4464	CLIP-seq
MIRT1421306	hsa-miR-4496	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1421308	hsa-miR-4506	CLIP-seq
MIRT1421309	hsa-miR-4516	CLIP-seq
MIRT1421310	hsa-miR-452	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT1421313	hsa-miR-4637	CLIP-seq
MIRT1421314	hsa-miR-4639-3p	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT1421316	hsa-miR-4653-5p	CLIP-seq
MIRT1421317	hsa-miR-4662a-5p	CLIP-seq
MIRT1421318	hsa-miR-4676-3p	CLIP-seq
MIRT1421319	hsa-miR-4680-3p	CLIP-seq
MIRT1421320	hsa-miR-4684-3p	CLIP-seq
MIRT1421321	hsa-miR-4691-3p	CLIP-seq
MIRT1421322	hsa-miR-4694-3p	CLIP-seq
MIRT1421323	hsa-miR-4698	CLIP-seq
MIRT1421324	hsa-miR-4699-3p	CLIP-seq
MIRT1421325	hsa-miR-4701-5p	CLIP-seq
MIRT1421326	hsa-miR-4711-3p	CLIP-seq
MIRT1421327	hsa-miR-4720-5p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1421329	hsa-miR-4748	CLIP-seq
MIRT1421330	hsa-miR-4753-3p	CLIP-seq
MIRT1421331	hsa-miR-4756-3p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT1421333	hsa-miR-4768-5p	CLIP-seq
MIRT1421334	hsa-miR-4774-5p	CLIP-seq
MIRT1421335	hsa-miR-4786-5p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT1421337	hsa-miR-4795-5p	CLIP-seq
MIRT1421338	hsa-miR-4799-3p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT1421341	hsa-miR-510	CLIP-seq
MIRT1421342	hsa-miR-512-5p	CLIP-seq
MIRT1421343	hsa-miR-520a-5p	CLIP-seq
MIRT1421344	hsa-miR-520g	CLIP-seq
MIRT1421345	hsa-miR-520h	CLIP-seq
MIRT1421346	hsa-miR-521	CLIP-seq
MIRT1421347	hsa-miR-522	CLIP-seq
MIRT1421348	hsa-miR-525-5p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT1421350	hsa-miR-545	CLIP-seq
MIRT1421351	hsa-miR-548a-5p	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT1421353	hsa-miR-548ab	CLIP-seq
MIRT1421354	hsa-miR-548ac	CLIP-seq
MIRT1421355	hsa-miR-548ak	CLIP-seq
MIRT1421356	hsa-miR-548b-5p	CLIP-seq
MIRT1421357	hsa-miR-548c-3p	CLIP-seq
MIRT1421358	hsa-miR-548c-5p	CLIP-seq
MIRT1421359	hsa-miR-548d-3p	CLIP-seq
MIRT1421360	hsa-miR-548d-5p	CLIP-seq
MIRT1421361	hsa-miR-548h	CLIP-seq
MIRT1421362	hsa-miR-548i	CLIP-seq
MIRT1421363	hsa-miR-548j	CLIP-seq
MIRT1421364	hsa-miR-548k	CLIP-seq
MIRT1421365	hsa-miR-548l	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT1421367	hsa-miR-548v	CLIP-seq
MIRT1421368	hsa-miR-548w	CLIP-seq
MIRT1421369	hsa-miR-548y	CLIP-seq
MIRT1421370	hsa-miR-548z	CLIP-seq
MIRT1421371	hsa-miR-559	CLIP-seq
MIRT1421372	hsa-miR-577	CLIP-seq
MIRT1421373	hsa-miR-579	CLIP-seq
MIRT1421374	hsa-miR-580	CLIP-seq
MIRT1421375	hsa-miR-587	CLIP-seq
MIRT1421376	hsa-miR-588	CLIP-seq
MIRT1421377	hsa-miR-640	CLIP-seq
MIRT1421378	hsa-miR-641	CLIP-seq
MIRT1421379	hsa-miR-665	CLIP-seq
MIRT1421380	hsa-miR-766	CLIP-seq
MIRT1421381	hsa-miR-885-5p	CLIP-seq
MIRT1421382	hsa-miR-921	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT1421384	hsa-miR-101	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT1421385	hsa-miR-130a	CLIP-seq
MIRT1421386	hsa-miR-130b	CLIP-seq
MIRT1421387	hsa-miR-1343	CLIP-seq
MIRT1421388	hsa-miR-144	CLIP-seq
MIRT1421389	hsa-miR-153	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT1421390	hsa-miR-2054	CLIP-seq
MIRT1421391	hsa-miR-301a	CLIP-seq
MIRT1421392	hsa-miR-301b	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT1421393	hsa-miR-3121-5p	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421394	hsa-miR-3164	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421395	hsa-miR-3194-3p	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT1421266	hsa-miR-337-3p	CLIP-seq
MIRT1421396	hsa-miR-3660	CLIP-seq
MIRT1421397	hsa-miR-3666	CLIP-seq
MIRT1421398	hsa-miR-3671	CLIP-seq
MIRT1421279	hsa-miR-3685	CLIP-seq
MIRT1421399	hsa-miR-371-5p	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT1421400	hsa-miR-376a	CLIP-seq
MIRT1421401	hsa-miR-376b	CLIP-seq
MIRT1421284	hsa-miR-384	CLIP-seq
MIRT1421402	hsa-miR-3977	CLIP-seq
MIRT1421403	hsa-miR-4254	CLIP-seq
MIRT1421294	hsa-miR-4291	CLIP-seq
MIRT1421404	hsa-miR-4295	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT1421405	hsa-miR-4422	CLIP-seq
MIRT1421301	hsa-miR-4434	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT1421406	hsa-miR-448	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1421308	hsa-miR-4506	CLIP-seq
MIRT1421309	hsa-miR-4516	CLIP-seq
MIRT1421407	hsa-miR-4526	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT1421408	hsa-miR-454	CLIP-seq
MIRT1421314	hsa-miR-4639-3p	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT1421317	hsa-miR-4662a-5p	CLIP-seq
MIRT1421409	hsa-miR-4671-3p	CLIP-seq
MIRT1421324	hsa-miR-4699-3p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT1421410	hsa-miR-4760-3p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT1421411	hsa-miR-489	CLIP-seq
MIRT1421412	hsa-miR-520d-5p	CLIP-seq
MIRT1421413	hsa-miR-524-5p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT1421350	hsa-miR-545	CLIP-seq
MIRT1421414	hsa-miR-548a-3p	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT1421415	hsa-miR-548e	CLIP-seq
MIRT1421416	hsa-miR-548f	CLIP-seq
MIRT1421417	hsa-miR-561	CLIP-seq
MIRT1421418	hsa-miR-578	CLIP-seq
MIRT1421373	hsa-miR-579	CLIP-seq
MIRT1421419	hsa-miR-584	CLIP-seq
MIRT1421420	hsa-miR-607	CLIP-seq
MIRT1421421	hsa-miR-619	CLIP-seq
MIRT1421422	hsa-miR-664	CLIP-seq
MIRT1421423	hsa-miR-711	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT1554589	hsa-miR-1294	CLIP-seq
MIRT1421387	hsa-miR-1343	CLIP-seq
MIRT1421239	hsa-miR-150	CLIP-seq
MIRT1421241	hsa-miR-181a	CLIP-seq
MIRT1421242	hsa-miR-181b	CLIP-seq
MIRT1421243	hsa-miR-181c	CLIP-seq
MIRT1421244	hsa-miR-181d	CLIP-seq
MIRT1554590	hsa-miR-192	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT1554591	hsa-miR-215	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT1421271	hsa-miR-3617	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT1421400	hsa-miR-376a	CLIP-seq
MIRT1421401	hsa-miR-376b	CLIP-seq
MIRT1554592	hsa-miR-3927	CLIP-seq
MIRT1421290	hsa-miR-4252	CLIP-seq
MIRT1421292	hsa-miR-4262	CLIP-seq
MIRT1554593	hsa-miR-4264	CLIP-seq
MIRT1554594	hsa-miR-4276	CLIP-seq
MIRT1421405	hsa-miR-4422	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1554595	hsa-miR-4650-3p	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1554597	hsa-miR-4773	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT1554598	hsa-miR-4797-3p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT1421365	hsa-miR-548l	CLIP-seq
MIRT1554599	hsa-miR-548n	CLIP-seq
MIRT1554600	hsa-miR-548t	CLIP-seq
MIRT1421378	hsa-miR-641	CLIP-seq
MIRT1554601	hsa-miR-642a	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT2126384	hsa-miR-1183	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT1421236	hsa-miR-1305	CLIP-seq
MIRT2126385	hsa-miR-145	CLIP-seq
MIRT1421241	hsa-miR-181a	CLIP-seq
MIRT1421242	hsa-miR-181b	CLIP-seq
MIRT1421243	hsa-miR-181c	CLIP-seq
MIRT1421244	hsa-miR-181d	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT2126386	hsa-miR-2115	CLIP-seq
MIRT2126387	hsa-miR-300	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2126388	hsa-miR-331-5p	CLIP-seq
MIRT1421266	hsa-miR-337-3p	CLIP-seq
MIRT2126389	hsa-miR-338-3p	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT1421283	hsa-miR-380	CLIP-seq
MIRT2126390	hsa-miR-381	CLIP-seq
MIRT2126391	hsa-miR-3910	CLIP-seq
MIRT2126392	hsa-miR-4255	CLIP-seq
MIRT1421292	hsa-miR-4262	CLIP-seq
MIRT1554593	hsa-miR-4264	CLIP-seq
MIRT2126393	hsa-miR-4272	CLIP-seq
MIRT2126394	hsa-miR-4282	CLIP-seq
MIRT1421294	hsa-miR-4291	CLIP-seq
MIRT2126395	hsa-miR-4325	CLIP-seq
MIRT2126396	hsa-miR-4436b-5p	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT2126397	hsa-miR-4493	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT2126398	hsa-miR-4530	CLIP-seq
MIRT1421314	hsa-miR-4639-3p	CLIP-seq
MIRT2126399	hsa-miR-4641	CLIP-seq
MIRT2126400	hsa-miR-4659a-3p	CLIP-seq
MIRT2126401	hsa-miR-4659b-3p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT1421324	hsa-miR-4699-3p	CLIP-seq
MIRT2126402	hsa-miR-4712-5p	CLIP-seq
MIRT2126403	hsa-miR-4727-5p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT2126404	hsa-miR-4769-3p	CLIP-seq
MIRT1421334	hsa-miR-4774-5p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT1421337	hsa-miR-4795-5p	CLIP-seq
MIRT1554598	hsa-miR-4797-3p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT2126405	hsa-miR-507	CLIP-seq
MIRT2126406	hsa-miR-5095	CLIP-seq
MIRT2126407	hsa-miR-516a-3p	CLIP-seq
MIRT1421344	hsa-miR-520g	CLIP-seq
MIRT1421345	hsa-miR-520h	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT2126408	hsa-miR-544	CLIP-seq
MIRT1421350	hsa-miR-545	CLIP-seq
MIRT1421354	hsa-miR-548ac	CLIP-seq
MIRT1421359	hsa-miR-548d-3p	CLIP-seq
MIRT1421365	hsa-miR-548l	CLIP-seq
MIRT1554599	hsa-miR-548n	CLIP-seq
MIRT1421370	hsa-miR-548z	CLIP-seq
MIRT2126409	hsa-miR-557	CLIP-seq
MIRT1421374	hsa-miR-580	CLIP-seq
MIRT1421375	hsa-miR-587	CLIP-seq
MIRT2126410	hsa-miR-676	CLIP-seq
MIRT2126411	hsa-miR-770-5p	CLIP-seq
MIRT1421381	hsa-miR-885-5p	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT2348396	hsa-miR-10a	CLIP-seq
MIRT2348397	hsa-miR-10b	CLIP-seq
MIRT2126384	hsa-miR-1183	CLIP-seq
MIRT2348398	hsa-miR-1206	CLIP-seq
MIRT2348399	hsa-miR-124	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT2348400	hsa-miR-1265	CLIP-seq
MIRT2348401	hsa-miR-1298	CLIP-seq
MIRT1421385	hsa-miR-130a	CLIP-seq
MIRT1421386	hsa-miR-130b	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT2348402	hsa-miR-1324	CLIP-seq
MIRT2348403	hsa-miR-133a	CLIP-seq
MIRT2348404	hsa-miR-133b	CLIP-seq
MIRT1421387	hsa-miR-1343	CLIP-seq
MIRT2348405	hsa-miR-142-5p	CLIP-seq
MIRT2126385	hsa-miR-145	CLIP-seq
MIRT2348406	hsa-miR-1976	CLIP-seq
MIRT1421390	hsa-miR-2054	CLIP-seq
MIRT2348407	hsa-miR-2110	CLIP-seq
MIRT2126386	hsa-miR-2115	CLIP-seq
MIRT2348408	hsa-miR-2392	CLIP-seq
MIRT1421391	hsa-miR-301a	CLIP-seq
MIRT1421392	hsa-miR-301b	CLIP-seq
MIRT2348409	hsa-miR-3115	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT2348410	hsa-miR-3120-3p	CLIP-seq
MIRT1421393	hsa-miR-3121-5p	CLIP-seq
MIRT1421255	hsa-miR-3128	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT2348411	hsa-miR-3145-3p	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT2348412	hsa-miR-3157-3p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2348413	hsa-miR-331-3p	CLIP-seq
MIRT2348414	hsa-miR-338-5p	CLIP-seq
MIRT2348415	hsa-miR-33a	CLIP-seq
MIRT2348416	hsa-miR-33b	CLIP-seq
MIRT2348417	hsa-miR-340	CLIP-seq
MIRT1421267	hsa-miR-34b	CLIP-seq
MIRT2348418	hsa-miR-34c-3p	CLIP-seq
MIRT1421271	hsa-miR-3617	CLIP-seq
MIRT1421396	hsa-miR-3660	CLIP-seq
MIRT1421275	hsa-miR-3662	CLIP-seq
MIRT2348419	hsa-miR-3663-3p	CLIP-seq
MIRT1421397	hsa-miR-3666	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT2348420	hsa-miR-3675-5p	CLIP-seq
MIRT2348421	hsa-miR-369-3p	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT2348422	hsa-miR-374a	CLIP-seq
MIRT2348423	hsa-miR-374b	CLIP-seq
MIRT1421400	hsa-miR-376a	CLIP-seq
MIRT1421401	hsa-miR-376b	CLIP-seq
MIRT1421282	hsa-miR-376c	CLIP-seq
MIRT2348424	hsa-miR-3922-5p	CLIP-seq
MIRT1421288	hsa-miR-3976	CLIP-seq
MIRT2126392	hsa-miR-4255	CLIP-seq
MIRT1421291	hsa-miR-4261	CLIP-seq
MIRT1554593	hsa-miR-4264	CLIP-seq
MIRT2348425	hsa-miR-4271	CLIP-seq
MIRT2348426	hsa-miR-4277	CLIP-seq
MIRT2348427	hsa-miR-4279	CLIP-seq
MIRT2348428	hsa-miR-4281	CLIP-seq
MIRT2348429	hsa-miR-4289	CLIP-seq
MIRT1421294	hsa-miR-4291	CLIP-seq
MIRT1421404	hsa-miR-4295	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT2126395	hsa-miR-4325	CLIP-seq
MIRT1421299	hsa-miR-433	CLIP-seq
MIRT1421405	hsa-miR-4422	CLIP-seq
MIRT2348430	hsa-miR-4438	CLIP-seq
MIRT1421304	hsa-miR-4460	CLIP-seq
MIRT2348431	hsa-miR-4471	CLIP-seq
MIRT1421310	hsa-miR-452	CLIP-seq
MIRT1421407	hsa-miR-4526	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT1421408	hsa-miR-454	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT2126400	hsa-miR-4659a-3p	CLIP-seq
MIRT2126401	hsa-miR-4659b-3p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT2348432	hsa-miR-4666-5p	CLIP-seq
MIRT1421409	hsa-miR-4671-3p	CLIP-seq
MIRT1421318	hsa-miR-4676-3p	CLIP-seq
MIRT2348433	hsa-miR-4687-3p	CLIP-seq
MIRT2348434	hsa-miR-4695-3p	CLIP-seq
MIRT2348435	hsa-miR-4717-3p	CLIP-seq
MIRT2348436	hsa-miR-4719	CLIP-seq
MIRT1421327	hsa-miR-4720-5p	CLIP-seq
MIRT2348437	hsa-miR-4725-3p	CLIP-seq
MIRT2348438	hsa-miR-4725-5p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT1421410	hsa-miR-4760-3p	CLIP-seq
MIRT1421334	hsa-miR-4774-5p	CLIP-seq
MIRT2348439	hsa-miR-4794	CLIP-seq
MIRT1421337	hsa-miR-4795-5p	CLIP-seq
MIRT1554598	hsa-miR-4797-3p	CLIP-seq
MIRT1421338	hsa-miR-4799-3p	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT2348440	hsa-miR-483-3p	CLIP-seq
MIRT1421411	hsa-miR-489	CLIP-seq
MIRT2348441	hsa-miR-504	CLIP-seq
MIRT2348442	hsa-miR-506	CLIP-seq
MIRT2126405	hsa-miR-507	CLIP-seq
MIRT2126406	hsa-miR-5095	CLIP-seq
MIRT2348443	hsa-miR-513b	CLIP-seq
MIRT2126407	hsa-miR-516a-3p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT2348444	hsa-miR-542-5p	CLIP-seq
MIRT1421350	hsa-miR-545	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT2348445	hsa-miR-548ae	CLIP-seq
MIRT2348446	hsa-miR-548aj	CLIP-seq
MIRT2348447	hsa-miR-548am	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT2348448	hsa-miR-548x	CLIP-seq
MIRT2348449	hsa-miR-556-3p	CLIP-seq
MIRT2126409	hsa-miR-557	CLIP-seq
MIRT1421417	hsa-miR-561	CLIP-seq
MIRT1421373	hsa-miR-579	CLIP-seq
MIRT2348450	hsa-miR-586	CLIP-seq
MIRT1421375	hsa-miR-587	CLIP-seq
MIRT2348451	hsa-miR-634	CLIP-seq
MIRT1421378	hsa-miR-641	CLIP-seq
MIRT1421423	hsa-miR-711	CLIP-seq
MIRT2348452	hsa-miR-802	CLIP-seq
MIRT2348453	hsa-miR-874	CLIP-seq
MIRT1421381	hsa-miR-885-5p	CLIP-seq
MIRT1421382	hsa-miR-921	CLIP-seq
MIRT2348454	hsa-miR-938	CLIP-seq
MIRT2395715	hsa-miR-24	CLIP-seq
MIRT2395716	hsa-miR-3155	CLIP-seq
MIRT2395717	hsa-miR-3155b	CLIP-seq
MIRT2348430	hsa-miR-4438	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT2395718	hsa-miR-484	CLIP-seq
MIRT2126406	hsa-miR-5095	CLIP-seq
MIRT2395719	hsa-miR-922	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT1421241	hsa-miR-181a	CLIP-seq
MIRT1421242	hsa-miR-181b	CLIP-seq
MIRT1421243	hsa-miR-181c	CLIP-seq
MIRT1421244	hsa-miR-181d	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT1421262	hsa-miR-3160-5p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421266	hsa-miR-337-3p	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT1421279	hsa-miR-3685	CLIP-seq
MIRT1421284	hsa-miR-384	CLIP-seq
MIRT2433827	hsa-miR-3936	CLIP-seq
MIRT2126392	hsa-miR-4255	CLIP-seq
MIRT1421292	hsa-miR-4262	CLIP-seq
MIRT2126394	hsa-miR-4282	CLIP-seq
MIRT2126397	hsa-miR-4493	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT1421314	hsa-miR-4639-3p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT2348432	hsa-miR-4666-5p	CLIP-seq
MIRT1421324	hsa-miR-4699-3p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT1421334	hsa-miR-4774-5p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT2433828	hsa-miR-4799-5p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT2433829	hsa-miR-500a	CLIP-seq
MIRT2348445	hsa-miR-548ae	CLIP-seq
MIRT2348446	hsa-miR-548aj	CLIP-seq
MIRT2348447	hsa-miR-548am	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT2348448	hsa-miR-548x	CLIP-seq
MIRT2433830	hsa-miR-659	CLIP-seq
MIRT2433831	hsa-miR-668	CLIP-seq
MIRT2433832	hsa-miR-9	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2126410	hsa-miR-676	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT2348396	hsa-miR-10a	CLIP-seq
MIRT2348397	hsa-miR-10b	CLIP-seq
MIRT2348398	hsa-miR-1206	CLIP-seq
MIRT2641158	hsa-miR-1252	CLIP-seq
MIRT2348400	hsa-miR-1265	CLIP-seq
MIRT2641159	hsa-miR-1270	CLIP-seq
MIRT2641160	hsa-miR-1275	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT2348402	hsa-miR-1324	CLIP-seq
MIRT2348405	hsa-miR-142-5p	CLIP-seq
MIRT2126385	hsa-miR-145	CLIP-seq
MIRT2641161	hsa-miR-183	CLIP-seq
MIRT1421245	hsa-miR-188-3p	CLIP-seq
MIRT2641162	hsa-miR-1909	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT2641163	hsa-miR-2053	CLIP-seq
MIRT1421390	hsa-miR-2054	CLIP-seq
MIRT2641164	hsa-miR-2278	CLIP-seq
MIRT2348408	hsa-miR-2392	CLIP-seq
MIRT1421252	hsa-miR-3064-3p	CLIP-seq
MIRT2641165	hsa-miR-3123	CLIP-seq
MIRT2641166	hsa-miR-3136-5p	CLIP-seq
MIRT2348411	hsa-miR-3145-3p	CLIP-seq
MIRT2641167	hsa-miR-3151	CLIP-seq
MIRT2641168	hsa-miR-3156-3p	CLIP-seq
MIRT2641169	hsa-miR-3160-3p	CLIP-seq
MIRT2641170	hsa-miR-3187-3p	CLIP-seq
MIRT2641171	hsa-miR-3192	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2641172	hsa-miR-3200-5p	CLIP-seq
MIRT2641173	hsa-miR-3202	CLIP-seq
MIRT2641174	hsa-miR-324-5p	CLIP-seq
MIRT2641175	hsa-miR-330-3p	CLIP-seq
MIRT2641176	hsa-miR-337-5p	CLIP-seq
MIRT2126389	hsa-miR-338-3p	CLIP-seq
MIRT2348417	hsa-miR-340	CLIP-seq
MIRT2641177	hsa-miR-3612	CLIP-seq
MIRT2641178	hsa-miR-3614-3p	CLIP-seq
MIRT1421274	hsa-miR-3646	CLIP-seq
MIRT1421275	hsa-miR-3662	CLIP-seq
MIRT1421399	hsa-miR-371-5p	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT1421282	hsa-miR-376c	CLIP-seq
MIRT2641179	hsa-miR-382	CLIP-seq
MIRT2348424	hsa-miR-3922-5p	CLIP-seq
MIRT1421286	hsa-miR-3925-3p	CLIP-seq
MIRT2641180	hsa-miR-3925-5p	CLIP-seq
MIRT2433827	hsa-miR-3936	CLIP-seq
MIRT1421288	hsa-miR-3976	CLIP-seq
MIRT2641181	hsa-miR-4270	CLIP-seq
MIRT2348426	hsa-miR-4277	CLIP-seq
MIRT2641182	hsa-miR-4287	CLIP-seq
MIRT2641183	hsa-miR-4301	CLIP-seq
MIRT2641184	hsa-miR-4303	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT2641185	hsa-miR-4314	CLIP-seq
MIRT2641186	hsa-miR-432	CLIP-seq
MIRT2641187	hsa-miR-4320	CLIP-seq
MIRT1421299	hsa-miR-433	CLIP-seq
MIRT2641188	hsa-miR-4330	CLIP-seq
MIRT2641189	hsa-miR-4420	CLIP-seq
MIRT2641190	hsa-miR-4439	CLIP-seq
MIRT2641191	hsa-miR-4441	CLIP-seq
MIRT2641192	hsa-miR-4447	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT2348431	hsa-miR-4471	CLIP-seq
MIRT2641193	hsa-miR-4472	CLIP-seq
MIRT2641194	hsa-miR-4487	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT2641195	hsa-miR-4513	CLIP-seq
MIRT2641196	hsa-miR-4520a-5p	CLIP-seq
MIRT2641197	hsa-miR-4520b-5p	CLIP-seq
MIRT2641198	hsa-miR-4525	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT2641199	hsa-miR-4529-5p	CLIP-seq
MIRT2126398	hsa-miR-4530	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT2641200	hsa-miR-4533	CLIP-seq
MIRT2126399	hsa-miR-4641	CLIP-seq
MIRT2641201	hsa-miR-4645-3p	CLIP-seq
MIRT1421317	hsa-miR-4662a-5p	CLIP-seq
MIRT2641202	hsa-miR-4665-5p	CLIP-seq
MIRT2348432	hsa-miR-4666-5p	CLIP-seq
MIRT2641203	hsa-miR-4670-3p	CLIP-seq
MIRT2641204	hsa-miR-4685-3p	CLIP-seq
MIRT2641205	hsa-miR-4686	CLIP-seq
MIRT2641206	hsa-miR-4688	CLIP-seq
MIRT1421322	hsa-miR-4694-3p	CLIP-seq
MIRT1421323	hsa-miR-4698	CLIP-seq
MIRT2641207	hsa-miR-4704-3p	CLIP-seq
MIRT2126402	hsa-miR-4712-5p	CLIP-seq
MIRT2348436	hsa-miR-4719	CLIP-seq
MIRT2641208	hsa-miR-4722-5p	CLIP-seq
MIRT2641209	hsa-miR-4723-5p	CLIP-seq
MIRT2348438	hsa-miR-4725-5p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT2641210	hsa-miR-4733-5p	CLIP-seq
MIRT2641211	hsa-miR-4762-5p	CLIP-seq
MIRT2641212	hsa-miR-4768-3p	CLIP-seq
MIRT2126404	hsa-miR-4769-3p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT2641213	hsa-miR-4792	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT2348440	hsa-miR-483-3p	CLIP-seq
MIRT2641214	hsa-miR-491-5p	CLIP-seq
MIRT2433829	hsa-miR-500a	CLIP-seq
MIRT2348441	hsa-miR-504	CLIP-seq
MIRT2348443	hsa-miR-513b	CLIP-seq
MIRT2641215	hsa-miR-515-5p	CLIP-seq
MIRT1421343	hsa-miR-520a-5p	CLIP-seq
MIRT1421348	hsa-miR-525-5p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT2348444	hsa-miR-542-5p	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT1421354	hsa-miR-548ac	CLIP-seq
MIRT2348445	hsa-miR-548ae	CLIP-seq
MIRT2641216	hsa-miR-548ag	CLIP-seq
MIRT2641217	hsa-miR-548ai	CLIP-seq
MIRT2348446	hsa-miR-548aj	CLIP-seq
MIRT2348447	hsa-miR-548am	CLIP-seq
MIRT1421359	hsa-miR-548d-3p	CLIP-seq
MIRT2641218	hsa-miR-548m	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT2348448	hsa-miR-548x	CLIP-seq
MIRT1421370	hsa-miR-548z	CLIP-seq
MIRT2348449	hsa-miR-556-3p	CLIP-seq
MIRT2641219	hsa-miR-558	CLIP-seq
MIRT2641220	hsa-miR-593	CLIP-seq
MIRT2641221	hsa-miR-620	CLIP-seq
MIRT2641222	hsa-miR-625	CLIP-seq
MIRT2348451	hsa-miR-634	CLIP-seq
MIRT2641223	hsa-miR-650	CLIP-seq
MIRT2641224	hsa-miR-657	CLIP-seq
MIRT2126410	hsa-miR-676	CLIP-seq
MIRT1421380	hsa-miR-766	CLIP-seq
MIRT2641225	hsa-miR-767-3p	CLIP-seq
MIRT2126411	hsa-miR-770-5p	CLIP-seq
MIRT2641226	hsa-miR-890	CLIP-seq
MIRT2641227	hsa-miR-892a	CLIP-seq
MIRT2641228	hsa-miR-944	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT2126384	hsa-miR-1183	CLIP-seq
MIRT2348398	hsa-miR-1206	CLIP-seq
MIRT2693008	hsa-miR-1207-3p	CLIP-seq
MIRT2693009	hsa-miR-1256	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT2693010	hsa-miR-1264	CLIP-seq
MIRT2348400	hsa-miR-1265	CLIP-seq
MIRT2641159	hsa-miR-1270	CLIP-seq
MIRT2641160	hsa-miR-1275	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT2348402	hsa-miR-1324	CLIP-seq
MIRT2348405	hsa-miR-142-5p	CLIP-seq
MIRT2126385	hsa-miR-145	CLIP-seq
MIRT2641161	hsa-miR-183	CLIP-seq
MIRT2693011	hsa-miR-186	CLIP-seq
MIRT1421245	hsa-miR-188-3p	CLIP-seq
MIRT2641162	hsa-miR-1909	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT2641163	hsa-miR-2053	CLIP-seq
MIRT1421390	hsa-miR-2054	CLIP-seq
MIRT2126386	hsa-miR-2115	CLIP-seq
MIRT2641164	hsa-miR-2278	CLIP-seq
MIRT2348408	hsa-miR-2392	CLIP-seq
MIRT1421252	hsa-miR-3064-3p	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT2641165	hsa-miR-3123	CLIP-seq
MIRT2693012	hsa-miR-3133	CLIP-seq
MIRT2693013	hsa-miR-3135b	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT2348411	hsa-miR-3145-3p	CLIP-seq
MIRT1421259	hsa-miR-3148	CLIP-seq
MIRT2641167	hsa-miR-3151	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT2641168	hsa-miR-3156-3p	CLIP-seq
MIRT2641169	hsa-miR-3160-3p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT2693014	hsa-miR-3170	CLIP-seq
MIRT2641170	hsa-miR-3187-3p	CLIP-seq
MIRT2641171	hsa-miR-3192	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2641172	hsa-miR-3200-5p	CLIP-seq
MIRT2641173	hsa-miR-3202	CLIP-seq
MIRT2641174	hsa-miR-324-5p	CLIP-seq
MIRT2641175	hsa-miR-330-3p	CLIP-seq
MIRT2641176	hsa-miR-337-5p	CLIP-seq
MIRT2126389	hsa-miR-338-3p	CLIP-seq
MIRT2348414	hsa-miR-338-5p	CLIP-seq
MIRT2348417	hsa-miR-340	CLIP-seq
MIRT1421269	hsa-miR-3607-3p	CLIP-seq
MIRT2641177	hsa-miR-3612	CLIP-seq
MIRT2641178	hsa-miR-3614-3p	CLIP-seq
MIRT1421270	hsa-miR-3614-5p	CLIP-seq
MIRT1421271	hsa-miR-3617	CLIP-seq
MIRT1421274	hsa-miR-3646	CLIP-seq
MIRT1421275	hsa-miR-3662	CLIP-seq
MIRT1421280	hsa-miR-3686	CLIP-seq
MIRT1421399	hsa-miR-371-5p	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT1421282	hsa-miR-376c	CLIP-seq
MIRT1421283	hsa-miR-380	CLIP-seq
MIRT2641179	hsa-miR-382	CLIP-seq
MIRT1421286	hsa-miR-3925-3p	CLIP-seq
MIRT2641180	hsa-miR-3925-5p	CLIP-seq
MIRT2433827	hsa-miR-3936	CLIP-seq
MIRT1421288	hsa-miR-3976	CLIP-seq
MIRT2126392	hsa-miR-4255	CLIP-seq
MIRT2693015	hsa-miR-4260	CLIP-seq
MIRT2641181	hsa-miR-4270	CLIP-seq
MIRT2348426	hsa-miR-4277	CLIP-seq
MIRT2641182	hsa-miR-4287	CLIP-seq
MIRT2641183	hsa-miR-4301	CLIP-seq
MIRT2641184	hsa-miR-4303	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT2641185	hsa-miR-4314	CLIP-seq
MIRT2641186	hsa-miR-432	CLIP-seq
MIRT2641187	hsa-miR-4320	CLIP-seq
MIRT2126395	hsa-miR-4325	CLIP-seq
MIRT1421299	hsa-miR-433	CLIP-seq
MIRT2641188	hsa-miR-4330	CLIP-seq
MIRT2641189	hsa-miR-4420	CLIP-seq
MIRT1421301	hsa-miR-4434	CLIP-seq
MIRT2641191	hsa-miR-4441	CLIP-seq
MIRT2641192	hsa-miR-4447	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT2641193	hsa-miR-4472	CLIP-seq
MIRT2693016	hsa-miR-4477a	CLIP-seq
MIRT2641194	hsa-miR-4487	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1421309	hsa-miR-4516	CLIP-seq
MIRT2641196	hsa-miR-4520a-5p	CLIP-seq
MIRT2641197	hsa-miR-4520b-5p	CLIP-seq
MIRT2641198	hsa-miR-4525	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT2641199	hsa-miR-4529-5p	CLIP-seq
MIRT2126398	hsa-miR-4530	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT2641200	hsa-miR-4533	CLIP-seq
MIRT2126399	hsa-miR-4641	CLIP-seq
MIRT2641201	hsa-miR-4645-3p	CLIP-seq
MIRT2126400	hsa-miR-4659a-3p	CLIP-seq
MIRT2126401	hsa-miR-4659b-3p	CLIP-seq
MIRT1421317	hsa-miR-4662a-5p	CLIP-seq
MIRT2641202	hsa-miR-4665-5p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT2348432	hsa-miR-4666-5p	CLIP-seq
MIRT2641203	hsa-miR-4670-3p	CLIP-seq
MIRT2641204	hsa-miR-4685-3p	CLIP-seq
MIRT2641205	hsa-miR-4686	CLIP-seq
MIRT2641206	hsa-miR-4688	CLIP-seq
MIRT1421322	hsa-miR-4694-3p	CLIP-seq
MIRT1421323	hsa-miR-4698	CLIP-seq
MIRT2641207	hsa-miR-4704-3p	CLIP-seq
MIRT2126402	hsa-miR-4712-5p	CLIP-seq
MIRT2348436	hsa-miR-4719	CLIP-seq
MIRT1421327	hsa-miR-4720-5p	CLIP-seq
MIRT2641208	hsa-miR-4722-5p	CLIP-seq
MIRT2641209	hsa-miR-4723-5p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT2641210	hsa-miR-4733-5p	CLIP-seq
MIRT2693017	hsa-miR-4744	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT2641211	hsa-miR-4762-5p	CLIP-seq
MIRT2641212	hsa-miR-4768-3p	CLIP-seq
MIRT2126404	hsa-miR-4769-3p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT2641213	hsa-miR-4792	CLIP-seq
MIRT1421338	hsa-miR-4799-3p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT2348440	hsa-miR-483-3p	CLIP-seq
MIRT2641214	hsa-miR-491-5p	CLIP-seq
MIRT2433829	hsa-miR-500a	CLIP-seq
MIRT2126405	hsa-miR-507	CLIP-seq
MIRT2348443	hsa-miR-513b	CLIP-seq
MIRT2641215	hsa-miR-515-5p	CLIP-seq
MIRT2126407	hsa-miR-516a-3p	CLIP-seq
MIRT1421343	hsa-miR-520a-5p	CLIP-seq
MIRT1421347	hsa-miR-522	CLIP-seq
MIRT1421348	hsa-miR-525-5p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT1421354	hsa-miR-548ac	CLIP-seq
MIRT2348445	hsa-miR-548ae	CLIP-seq
MIRT2641216	hsa-miR-548ag	CLIP-seq
MIRT2641217	hsa-miR-548ai	CLIP-seq
MIRT2348446	hsa-miR-548aj	CLIP-seq
MIRT2348447	hsa-miR-548am	CLIP-seq
MIRT1421359	hsa-miR-548d-3p	CLIP-seq
MIRT1421364	hsa-miR-548k	CLIP-seq
MIRT2641218	hsa-miR-548m	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT2348448	hsa-miR-548x	CLIP-seq
MIRT1421370	hsa-miR-548z	CLIP-seq
MIRT2348449	hsa-miR-556-3p	CLIP-seq
MIRT2126409	hsa-miR-557	CLIP-seq
MIRT2641219	hsa-miR-558	CLIP-seq
MIRT2693018	hsa-miR-570	CLIP-seq
MIRT2641220	hsa-miR-593	CLIP-seq
MIRT2641221	hsa-miR-620	CLIP-seq
MIRT2641222	hsa-miR-625	CLIP-seq
MIRT2348451	hsa-miR-634	CLIP-seq
MIRT1421378	hsa-miR-641	CLIP-seq
MIRT2641223	hsa-miR-650	CLIP-seq
MIRT2641224	hsa-miR-657	CLIP-seq
MIRT2126410	hsa-miR-676	CLIP-seq
MIRT1421380	hsa-miR-766	CLIP-seq
MIRT2641225	hsa-miR-767-3p	CLIP-seq
MIRT2126411	hsa-miR-770-5p	CLIP-seq
MIRT2641226	hsa-miR-890	CLIP-seq
MIRT2641227	hsa-miR-892a	CLIP-seq
MIRT2641228	hsa-miR-944	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
SMAD7	Repression	15221015
WWP1	Repression	15221015

195

Show/Hide all (195)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001501	Process	Skeletal system development	IEA
GO:0001501	Process	Skeletal system development	ISS
GO:0001525	Process	Angiogenesis	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001701	Process	In utero embryonic development	ISS
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0001824	Process	Blastocyst development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	15761148
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	ISS
GO:0002088	Process	Lens development in camera-type eye	IEA
GO:0003222	Process	Ventricular trabecula myocardium morphogenesis	IEA
GO:0003222	Process	Ventricular trabecula myocardium morphogenesis	ISS
GO:0003223	Process	Ventricular compact myocardium morphogenesis	IEA
GO:0003223	Process	Ventricular compact myocardium morphogenesis	ISS
GO:0003342	Process	Proepicardium development	ISS
GO:0004672	Function	Protein kinase activity	IDA	19736306
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12065756, 18625725
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004675	Function	Transmembrane receptor protein serine/threonine kinase activity	IDA	12015308, 19736306
GO:0004675	Function	Transmembrane receptor protein serine/threonine kinase activity	IEA
GO:0005024	Function	Transforming growth factor beta receptor activity	IC	1326540
GO:0005024	Function	Transforming growth factor beta receptor activity	IDA	12015308, 12065756, 14633705
GO:0005024	Function	Transforming growth factor beta receptor activity	IEA
GO:0005024	Function	Transforming growth factor beta receptor activity	IMP	1333888
GO:0005024	Function	Transforming growth factor beta receptor activity	IMP	18625725
GO:0005025	Function	Transforming growth factor beta receptor activity, type I	IBA
GO:0005025	Function	Transforming growth factor beta receptor activity, type I	IDA	8752209
GO:0005025	Function	Transforming growth factor beta receptor activity, type I	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IDA	11157754
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IPI	1333888
GO:0005515	Function	Protein binding	IPI	8622651, 10025408, 11278302, 11279102, 11583628, 12015308, 14517293, 14580334, 15702480, 15761148, 17099224, 18243111, 18625725, 18758450, 18974388, 19732720, 20856203, 21791611, 22344298, 23723426, 23868260, 24263861, 24658140, 25893292, 26583432
GO:0005524	Function	ATP binding	IDA	12065756
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	26583432
GO:0005654	Component	Nucleoplasm	IDA
GO:0005768	Component	Endosome	IDA	26583432
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17878231, 21791611, 25893292
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	18243111, 20207738
GO:0005886	Component	Plasma membrane	TAS
GO:0005923	Component	Bicellular tight junction	IDA	15761148
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005929	Component	Cilium	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	14517293
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	15702480
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IDA	14633705
GO:0007178	Process	Cell surface receptor protein serine/threonine kinase signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IC	1326540
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	18548003
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	1333888, 9311995, 9389648, 11157754, 12065756
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IGI	22714950
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	1333888, 24978044, 27693460, 28251559
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	ISS
GO:0007399	Process	Nervous system development	IBA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	14633705
GO:0008354	Process	Germ cell migration	IEA
GO:0008354	Process	Germ cell migration	ISS
GO:0008584	Process	Male gonad development	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009952	Process	Anterior/posterior pattern specification	ISS
GO:0009986	Component	Cell surface	IDA	25893292
GO:0009986	Component	Cell surface	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010468	Process	Regulation of gene expression	ISS
GO:0010628	Process	Positive regulation of gene expression	IMP	27162619
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016361	Function	Activin receptor activity, type I	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15761148
GO:0019838	Function	Growth factor binding	IPI	14517293
GO:0030154	Process	Cell differentiation	IEA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030199	Process	Collagen fibril organization	ISS
GO:0030307	Process	Positive regulation of cell growth	IDA	18625725
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	19736306
GO:0030336	Process	Negative regulation of cell migration	IMP	23424236
GO:0031396	Process	Regulation of protein ubiquitination	IDA	18758450
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	12151385
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IEA
GO:0032331	Process	Negative regulation of chondrocyte differentiation	ISS
GO:0032924	Process	Activin receptor signaling pathway	IBA
GO:0032924	Process	Activin receptor signaling pathway	ISS
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0036446	Process	Myofibroblast differentiation	IMP	28251559
GO:0042060	Process	Wound healing	TAS	9759503
GO:0042118	Process	Endothelial cell activation	ISS
GO:0043062	Process	Extracellular structure organization	TAS	9759503
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043235	Component	Receptor complex	IDA	8774881, 14517293
GO:0043542	Process	Endothelial cell migration	IEA
GO:0045121	Component	Membrane raft	IDA	25893292
GO:0045121	Component	Membrane raft	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9311995, 9389648
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0046332	Function	SMAD binding	IBA
GO:0046332	Function	SMAD binding	IDA	12065756, 18625725
GO:0046332	Function	SMAD binding	IEA
GO:0046332	Function	SMAD binding	IPI	8980228, 9311995
GO:0046847	Process	Filopodium assembly	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048179	Component	Activin receptor complex	IBA
GO:0048185	Function	Activin binding	IBA
GO:0048538	Process	Thymus development	IEA
GO:0048538	Process	Thymus development	ISS
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048663	Process	Neuron fate commitment	ISS
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	ISS
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0048705	Process	Skeletal system morphogenesis	ISS
GO:0048762	Process	Mesenchymal cell differentiation	ISS
GO:0048762	Process	Mesenchymal cell differentiation	TAS	9759503
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	ISS
GO:0048870	Process	Cell motility	IMP	18625725
GO:0050431	Function	Transforming growth factor beta binding	IDA	11157754
GO:0050431	Function	Transforming growth factor beta binding	IDA	14633705
GO:0050431	Function	Transforming growth factor beta binding	IEA
GO:0050431	Function	Transforming growth factor beta binding	IMP	1333888
GO:0050431	Function	Transforming growth factor beta binding	IPI	1326540
GO:0050431	Function	Transforming growth factor beta binding	ISS
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS
GO:0051726	Process	Regulation of cell cycle	TAS	9759503
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18625725
GO:0060017	Process	Parathyroid gland development	IEA
GO:0060017	Process	Parathyroid gland development	ISS
GO:0060021	Process	Roof of mouth development	IEA
GO:0060021	Process	Roof of mouth development	ISS
GO:0060037	Process	Pharyngeal system development	IEA
GO:0060037	Process	Pharyngeal system development	ISS
GO:0060043	Process	Regulation of cardiac muscle cell proliferation	IEA
GO:0060043	Process	Regulation of cardiac muscle cell proliferation	ISS
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	ISS
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	9311995, 9389648, 11157754, 12015308, 18625725, 19736306
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IGI	22714950
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IMP	27693460
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060978	Process	Angiogenesis involved in coronary vascular morphogenesis	IEA
GO:0060978	Process	Angiogenesis involved in coronary vascular morphogenesis	ISS
GO:0060982	Process	Coronary artery morphogenesis	IEA
GO:0060982	Process	Coronary artery morphogenesis	ISS
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0070021	Component	Transforming growth factor beta ligand-receptor complex	IPI	18243111, 20207738
GO:0070021	Component	Transforming growth factor beta ligand-receptor complex	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0070411	Function	I-SMAD binding	IPI	11278251
GO:0070723	Process	Response to cholesterol	IDA	17878231
GO:0070723	Process	Response to cholesterol	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IBA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	19494318
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0097305	Process	Response to alcohol	IEA
GO:0101023	Process	Vascular endothelial cell proliferation	IBA
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IMP	28251559
GO:1902462	Process	Positive regulation of mesenchymal stem cell proliferation	IGI	22714950
GO:1902554	Component	Serine/threonine protein kinase complex	IEA
GO:1904018	Process	Positive regulation of vasculature development	IMP	27693460
GO:1905007	Process	Positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	IEA
GO:1905007	Process	Positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:1905075	Process	Positive regulation of tight junction disassembly	IEA
GO:1905075	Process	Positive regulation of tight junction disassembly	ISS
GO:1905223	Process	Epicardium morphogenesis	IEA
GO:1905223	Process	Epicardium morphogenesis	ISS
GO:2000026	Process	Regulation of multicellular organismal development	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	18758450
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IMP	18625725

MIM	HGNC	e!Ensembl
190181	11772	ENSG00000106799

P36897

Protein name

TGF-beta receptor type-1 (TGFR-1) (EC 2.7.11.30) (Activin A receptor type II-like protein kinase of 53kD) (Activin receptor-like kinase 5) (ALK-5) (ALK5) (Serine/threonine-protein kinase receptor R4) (SKR4) (TGF-beta type I receptor) (Transforming growth

Protein function

Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from t

PDB

1B6C , 1IAS , 1PY5 , 1RW8 , 1VJY , 2L5S , 2PJY , 2WOT , 2WOU , 2X7O , 3FAA , 3GXL , 3HMM , 3KCF , 3KFD , 3TZM , 4X0M , 4X2F , 4X2G , 4X2J , 4X2K , 4X2N , 5E8S , 5E8T , 5E8U , 5E8W , 5E8X , 5E8Z , 5E90 , 5FRI , 5QIK , 5QIL , 5QIM , 5QTZ , 5QU0 , 5USQ , 6B8Y , 6MAC , 8YHF , 8YHL , 9B9F , 9F6X , 9FK5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01064	Activin_recp	34 → 110	Activin types I and II receptor domain	Domain
PF08515	TGF_beta_GS	176 → 203	Transforming growth factor beta type I GS-motif	Family
PF00069	Pkinase	205 → 492	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in all tissues examined, most abundant in placenta and least abundant in brain and heart. Expressed in a variety of cancer cell lines (PubMed:25893292). {ECO:0000269|PubMed:25893292}.

Sequence

MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM

Sequence length

503

Interactions

View interactions

1511

Show/Hide Causal Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cardiovascular phenotype	Pathogenic; Likely pathogenic	rs113605875, rs111854391	RCV005403720 RCV000617152
Ehlers-Danlos syndrome	Likely pathogenic	rs863223811	RCV005625436
Familial aortopathy	Likely pathogenic; Pathogenic	rs760079636, rs1060502046	RCV003235118 RCV001174650
Familial thoracic aortic aneurysm and aortic dissection	Likely pathogenic; Pathogenic	rs1827496704, rs1827126921, rs2118780524, rs2118804176, rs2118807458, rs2118803591, rs2118827924, rs2118841181, rs2118563240, rs2118707001, rs2118630690, rs2118840018, rs2118805827, rs730880223, rs2490192138 View all (42 more)	RCV001322257 RCV003529479 RCV001379085 RCV001380154 RCV002540399 RCV002034646 RCV002542416 RCV002027689 RCV001985305 RCV001977635 RCV001993206 RCV001993470 RCV002304883 RCV002516367 RCV002394203 RCV002389083 RCV002746247 RCV001380058 RCV001187849 RCV001170914 RCV002975956 RCV003019221 RCV003042890 RCV003150768 RCV002310832 RCV001042584 RCV002310869 RCV000244262 RCV000211857 RCV000211856 RCV003528871 RCV003529113 RCV003529350 RCV003529731 RCV003643539 RCV003643813 RCV003644045 RCV003644398 RCV003644382 RCV003643483 RCV003818769 RCV003837750 RCV000474057 RCV000471274 RCV000464356 RCV000473430 RCV000538139 RCV000551498 RCV000614164 RCV000605493 RCV002315262 RCV002315260 RCV000660318 RCV000698286 RCV000766264 RCV001065118 RCV001227976 RCV002436985
Loeys-Dietz syndrome	Pathogenic; Likely pathogenic	rs730880223, rs863223829, rs760079636, rs863223818, rs886038919, rs111854391, rs113605875, rs111426349, rs1588598651, rs1554701911	RCV000157517 RCV000825630 RCV000208245 RCV003993884 RCV000582499 RCV000030540 RCV000211857 RCV000211856 RCV003533864 RCV000584165
Loeys-Dietz syndrome 1	Likely pathogenic; Pathogenic	rs1827496704, rs1827647083, rs2118780524, rs727503470, rs2118827924, rs2118858700, rs863223819, rs760079636, rs121918710, rs121918711, rs121918712, rs113605875, rs111854391, rs111426349, rs2118711701 View all (4 more)	RCV005050332 RCV001336713 RCV004594277 RCV001775443 RCV001806343 RCV002471487 RCV003147394 RCV002255135 RCV000119102 RCV000013346 RCV000013347 RCV000013348 RCV000013350 RCV000013351 RCV000013352 RCV005871247 RCV004017184 RCV000578271 RCV000623721 RCV000984475 RCV001280800
Marfan syndrome	Likely pathogenic; Pathogenic	rs886038919, rs111854391	RCV002288945 RCV000845292
Multiple self-healing squamous epithelioma	Likely pathogenic; Pathogenic	rs1827496704, rs2118805586, rs2490104710, rs760079636, rs1827497991, rs111854391, rs111426349, rs387906697	RCV005050332 RCV001788938 RCV006249823 RCV005049472 RCV003333386 RCV003224094 RCV000763611 RCV000022805
TGFBR1-related disorder	Pathogenic	rs113605875	RCV004730845

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	rs199545273, rs7871490, rs201054018, rs201772204	RCV005900423 RCV005900426 RCV005900430 RCV005908921
Aortic aneurysm, familial thoracic 6	Uncertain significance	rs1564176059	RCV000845496
Connective tissue disorder	Likely benign	rs1564149227	RCV000680611
Craniosynostosis syndrome	Uncertain significance	rs201910738	RCV000985274
Disproportionate tall stature	Conflicting classifications of pathogenicity	rs869025535	RCV001837763
Ehlers-Danlos syndrome, classic type	Conflicting classifications of pathogenicity	rs1564161224	RCV000766263
Familial cancer of breast	Benign	rs747755454	RCV005871298
Gastric cancer	Benign	rs747755454	RCV005871299
Isolated thoracic aortic aneurysm	Uncertain significance; Conflicting classifications of pathogenicity	rs387906696, rs1564161322	RCV001374784 RCV001374785
Malignant tumor of esophagus	Uncertain significance	rs7871490	RCV005900427
Malignant tumor of urinary bladder	Uncertain significance	rs2118779242	RCV005923981
Myoepithelial tumor	Uncertain significance	rs2490095827	RCV002463921
Ovarian serous cystadenocarcinoma	Uncertain significance	rs60885995, rs1827266142	RCV005908834 RCV005908923
Sarcoma	Uncertain significance; Conflicting classifications of pathogenicity	rs199545273, rs201054018, rs60885995	RCV005900424 RCV005900431 RCV005908833
See cases	Conflicting classifications of pathogenicity; Uncertain significance	rs1324785971, rs2118803865, rs200595614	RCV002252851 RCV002253046 RCV004797908
Thoracic aortic aneurysm	Benign; Likely benign	rs11466445	RCV003148659
Thymoma	Uncertain significance	rs7871490	RCV005900428
Uterine corpus endometrial carcinoma	Uncertain significance	rs199545273, rs7871490, rs200898127	RCV005900425 RCV005900429 RCV005900422

Show/Hide Text Mining Associations (170)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	33769671, 34036102
Albinism Oculocutaneous	Associate	30219046
Aneurysm	Associate	16928994, 37864304
Aortic Aneurysm	Associate	18781618, 40243722
Aortic Aneurysm Abdominal	Associate	19672284, 26027897
Aortic Aneurysm Familial Thoracic 1	Associate	18781618, 23099432, 29510914
Aortic Aneurysm Thoracic	Associate	19672284, 26017485
Aortic Diseases	Associate	27879313, 32062130, 36599937
Aortic Dissection	Associate	20648054, 21815248, 28847661, 31475485, 31915033, 35078481, 40243722
Apical Hypertrophic Cardiomyopathy	Associate	32528555
Arteriovenous Malformations	Associate	33789563
Arthritis	Associate	17317656
Arthritis Rheumatoid	Associate	17594488, 20628268
Asthma	Associate	23884466
Astrocytoma	Associate	30987013
Atrial Fibrillation	Associate	31539152
Behcet Syndrome	Associate	18925687
Biliary Tract Neoplasms	Associate	37341068
Bohring syndrome	Associate	27234654
Breast Neoplasms	Associate	17848193, 17848956, 18625725, 20332227, 21527583, 21829601, 22260435, 23022998, 23349840, 24658161, 26165686, 26703884, 28059167, 30987013, 33626035, 34093853, 35381768, 35484112 View all (3 more)
Bursitis	Associate	30667085
Camurati Engelmann Syndrome	Associate	18591412
Capillary Malformation Arteriovenous Malformation	Associate	33789563
Carcinoma Basal Cell	Associate	8688329
Carcinoma Endometrioid	Associate	27533245
Carcinoma Hepatocellular	Associate	26648552, 28230858, 28594404, 29515105, 30943320, 32324847, 33684566, 36901700, 37044053, 39256453, 7639583
Carcinoma Non Small Cell Lung	Associate	19690145, 34628486
Carcinoma Ovarian Epithelial	Associate	26091707, 27533245
Carcinoma Pancreatic Ductal	Associate	25791160, 26588899
Carcinoma Renal Cell	Associate	27166254, 31339433
Carcinoma Squamous Cell	Inhibit	21819702
Carcinosarcoma	Associate	25918253
Cardiomyopathies	Associate	31169351
Cardiovascular Diseases	Associate	31915033
Cell Transformation Neoplastic	Inhibit	11444526
Cicatrix	Associate	36826843
Cleft Palate	Associate	15731757
Colonic Neoplasms	Associate	19538729
Colorectal Neoplasms	Associate	17890272, 18703712, 18778720, 19401691, 19509225, 19538729, 20500843, 20705955, 21068203, 21811255, 22278155, 22292045, 24981199, 26714817, 27234654 View all (6 more)
Colorectal Neoplasms	Stimulate	19930569
Connective Tissue Diseases	Associate	30675029
Constriction Pathologic	Associate	18756605
Coronary Artery Dissection Spontaneous	Associate	33866193, 35092149
COVID 19	Associate	35746781
Dermatitis Atopic	Associate	29498756
Diabetes Gestational	Stimulate	34930438
Diabetic Nephropathies	Stimulate	17319955
Diffuse Intrinsic Pontine Glioma	Associate	32273545
Dissection Ascending Aorta	Associate	34346740
Drug Hypersensitivity	Associate	23884466
Drug Related Side Effects and Adverse Reactions	Associate	28031235
Drug Related Side Effects and Adverse Reactions	Inhibit	36775873
Duane Retraction Syndrome	Inhibit	19344999
Eczema	Associate	23884466
Ehlers Danlos Syndrome Type IV	Associate	16928994
Endometrial Neoplasms	Associate	27171242, 36791912
Endometrial Neoplasms	Inhibit	27171242
Endometriosis	Associate	28277133, 32635855
Familial Primary Pulmonary Hypertension	Associate	25644172, 36007983
Fanconi Syndrome	Associate	34110636
Fibrocartilaginous embolism	Associate	22907063
Fibrosis	Associate	23520204, 40436765
Food Hypersensitivity	Associate	23884466
Friedreich Ataxia 1	Associate	33905626
Gastrointestinal Diseases	Associate	23884466
Glioblastoma	Associate	25165192
Glioma	Associate	33494271, 37439825
Glomerulonephritis	Associate	28815607
Goiter	Associate	33905626
Head and Neck Neoplasms	Associate	17890272
Head and Neck Neoplasms	Stimulate	25273091
Heart Defects Congenital	Associate	15731757
Heart Diseases	Associate	32443848, 35078481
Heart Failure	Associate	32528555
Hepatitis C	Associate	29061957
Hepatitis C Chronic	Associate	25502482, 29061957
Hereditary Breast and Ovarian Cancer Syndrome	Associate	15385056
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	19930569
Hernia Inguinal	Associate	31910207
Hydrocephalus	Associate	40325597
Hypertrophy	Associate	35406794
Hypospadias	Associate	28894026
Hypothyroidism Congenital Nongoitrous 2	Stimulate	26675296
Hypoxia	Associate	22705563, 26090865, 31169351, 31339433, 32528555
Idiopathic Pulmonary Fibrosis	Associate	11713352
Immunoglobulin G4 Related Disease	Associate	12974945
Inflammation	Inhibit	29367682
Inflammation	Associate	29498756, 30677026, 37083272
Intellectual Disability	Associate	15731757
Intracranial Aneurysm	Associate	15731757
Kashin Beck Disease	Associate	29514696
Keratoacanthoma familial	Associate	29706644, 36599937, 8688329
Leukemia Lymphocytic Chronic B Cell	Associate	22905131
Leukemia Myeloid Acute	Associate	40184725
Lichen Planus Oral	Associate	14675171
Loeys Dietz Syndrome	Associate	16928994, 18781618, 19883511, 21267002, 22095581, 23884466, 24495977, 24499874, 25116393, 25163805, 28847661, 29706644, 29768367, 30219046, 31475485 View all (15 more)
Lung Neoplasms	Associate	24816813, 33231090
Lupus Erythematosus Systemic	Associate	17364494, 19020994
Lymphatic Metastasis	Associate	22278155
Lymphoma	Associate	32335702
Lymphoma Large B Cell Diffuse	Associate	31797450, 36281462
Lymphoma Mantle Cell	Associate	33648463
Macular Degeneration	Associate	23455636, 33618707
Marfan Syndrome	Associate	17652900, 18781618, 20354336, 22300218, 28847661, 40243722
Megalencephaly	Associate	40325597
Melanoma	Associate	25204799, 32327630
Melanoma Cutaneous Malignant	Associate	17565341
Melanoma Cutaneous Malignant	Stimulate	37730606
Mesothelioma	Stimulate	36901697
Mitral Valve Insufficiency	Associate	30219046
Multiple Myeloma	Associate	26433312
Multiple Sclerosis	Inhibit	29295981
Mycobacterium Infections Nontuberculous	Associate	34203447
Myocardial Infarction	Associate	22136666
Myocardial Ischemia	Associate	31169351
Nasal Polyps	Associate	29367682
Nasopharyngeal Carcinoma	Associate	29017171
Neoplasm Metastasis	Associate	20429896, 26620926, 26811494, 32844403, 37443102
Neoplasms	Associate	10333714, 12912863, 17309779, 17848956, 17890272, 18299279, 18778720, 18925687, 19401691, 19509225, 19538729, 22473997, 23022998, 25173755, 25273091 View all (15 more)
Neoplastic Cells Circulating	Associate	37569332
Neuralgia	Associate	12928636
NOG Related Symphalangism Spectrum Disorder	Associate	10333714
Non functioning pancreatic endocrine tumor	Associate	23211371
O'Donnell Pappas syndrome	Associate	12928636
Oropharyngeal Neoplasms	Stimulate	25273091
Osteoarthritis	Associate	29514696
Osteosarcoma	Associate	20429896, 30710564
Ovarian Diseases	Associate	34630324
Ovarian Neoplasms	Associate	26983758, 28064471, 34884451
Pancreatic Neoplasms	Associate	25791160, 26586478, 27035876
Pancreatic Neoplasms	Stimulate	33062039
Pancreatitis Acute Necrotizing	Associate	9445116
Pancreatitis Chronic	Associate	10400038
Personality Disorders	Inhibit	30987013
Polycythemia Vera	Associate	35427808
Polyps	Stimulate	29367682
Pre Eclampsia	Associate	34523694
Prostatic Neoplasms	Associate	22705563, 25622187, 26152726, 26583432, 27166254, 29257105, 30138363, 30973040
Pulmonary Fibrosis	Associate	37724521
Q Fever	Associate	28179203
Rectal Neoplasms	Associate	19538729
Renal Insufficiency Chronic	Associate	8840277
Retinitis	Associate	30219046
Rhinitis Allergic	Associate	23884466, 33596578
Rhinitis Allergic Seasonal	Stimulate	18201469
Rotator Cuff Injuries	Associate	31444797
Scleroderma Systemic	Associate	17317656, 26357964
Scoliosis	Associate	26333736
Shprintzen Golberg craniosynostosis	Associate	18781618
Skin Neoplasms	Associate	35886018
Spinal Cord Injuries	Associate	33982670
Spinocerebellar Degenerations	Associate	27234654
Squamous Cell Carcinoma of Head and Neck	Associate	31831099, 38287071, 39177040
Stomach Neoplasms	Associate	1312080, 23188426, 25173755, 26811494, 28522256
Tarlov Cysts	Stimulate	38287071
Thoracic Diseases	Associate	36007983
Thyroid Cancer Papillary	Associate	28849102, 29274137
Thyroid Cancer Papillary	Stimulate	33905626
Thyroid Nodule	Associate	33905626
Triple Negative Breast Neoplasms	Associate	34326372
Urinary Bladder Neoplasms	Associate	18311384, 19004027
Uterine Cervical Neoplasms	Associate	25273091, 31435875
Uterine Diseases	Associate	32635855
Uterine Neoplasms	Associate	36791912
Varicose Ulcer	Associate	20069132
Vascular Diseases	Associate	16928994
Vascular System Injuries	Associate	16594992
Ventricular Dysfunction Left	Associate	22136666
Virus Diseases	Associate	28046097
Wounds and Injuries	Associate	31169351, 32528555

TGFBR1 (transforming growth factor beta receptor 1)