Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6934
Gene name	Transcription factor 7 like 2
Gene symbol	TCF7L2
Synonyms (NCBI Gene)	TCF-4TCF4
Chromosome	10
Chromosome location	10q25.2-q25.3
Summary	This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs7903146	C>G,T	Drug-response, risk-factor	Intron variant, genic upstream transcript variant
rs11196205	G>A,C,T	Risk-factor	Intron variant, genic upstream transcript variant
rs12255372	G>A,T	Risk-factor	Intron variant, genic upstream transcript variant

478

Show/Hide all (478)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043583	hsa-miR-148b-3p	CLASH	23622248
MIRT043052	hsa-miR-324-5p	CLASH	23622248
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT641843	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT641842	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT641841	hsa-miR-6768-3p	HITS-CLIP	23824327
MIRT641840	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT641839	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT641838	hsa-miR-3938	HITS-CLIP	23824327
MIRT641837	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT641836	hsa-miR-623	HITS-CLIP	23824327
MIRT641835	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT641834	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT621862	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT261341	hsa-miR-8063	HITS-CLIP	23824327
MIRT261338	hsa-miR-4698	HITS-CLIP	23824327
MIRT621858	hsa-miR-1305	HITS-CLIP	23824327
MIRT621862	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT621861	hsa-miR-8485	HITS-CLIP	23824327
MIRT621860	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT621859	hsa-miR-421	HITS-CLIP	23824327
MIRT621858	hsa-miR-1305	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT261349	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT261342	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT261347	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT553717	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT553716	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT553715	hsa-miR-4295	PAR-CLIP	21572407
MIRT553714	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT553713	hsa-miR-3666	PAR-CLIP	21572407
MIRT553712	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT553711	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT553710	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT553709	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT553708	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT553707	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT553706	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT553705	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT553704	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT553703	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT553702	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT553701	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT553700	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT553698	hsa-miR-4759	PAR-CLIP	21572407
MIRT553699	hsa-miR-3169	PAR-CLIP	21572407
MIRT553697	hsa-miR-8083	PAR-CLIP	21572407
MIRT261354	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT553696	hsa-miR-5193	PAR-CLIP	21572407
MIRT553695	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT553694	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT553693	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT553692	hsa-miR-891b	PAR-CLIP	21572407
MIRT553691	hsa-miR-3117-3p	PAR-CLIP	21572407
MIRT553690	hsa-miR-651-5p	PAR-CLIP	21572407
MIRT505430	hsa-miR-200b-3p	PAR-CLIP	21572407
MIRT505429	hsa-miR-200c-3p	PAR-CLIP	21572407
MIRT505428	hsa-miR-429	PAR-CLIP	21572407
MIRT505427	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT505426	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT505425	hsa-miR-1-5p	PAR-CLIP	21572407
MIRT505424	hsa-miR-4418	PAR-CLIP	21572407
MIRT505423	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT505422	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT505421	hsa-miR-217	PAR-CLIP	21572407
MIRT505420	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT505419	hsa-miR-892b	PAR-CLIP	21572407
MIRT505418	hsa-miR-3919	PAR-CLIP	21572407
MIRT505416	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT505415	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT505414	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT505413	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT505412	hsa-miR-1298-5p	PAR-CLIP	21572407
MIRT505411	hsa-miR-4435	PAR-CLIP	21572407
MIRT505430	hsa-miR-200b-3p	PAR-CLIP	23446348
MIRT505429	hsa-miR-200c-3p	PAR-CLIP	23446348
MIRT505428	hsa-miR-429	PAR-CLIP	23446348
MIRT505427	hsa-miR-193b-3p	PAR-CLIP	23446348
MIRT505426	hsa-miR-193a-3p	PAR-CLIP	23446348
MIRT505425	hsa-miR-1-5p	PAR-CLIP	23446348
MIRT505424	hsa-miR-4418	PAR-CLIP	23446348
MIRT505423	hsa-miR-509-3-5p	PAR-CLIP	23446348
MIRT505422	hsa-miR-509-5p	PAR-CLIP	23446348
MIRT505421	hsa-miR-217	PAR-CLIP	23446348
MIRT505420	hsa-miR-6807-3p	PAR-CLIP	23446348
MIRT505419	hsa-miR-892b	PAR-CLIP	23446348
MIRT505418	hsa-miR-3919	PAR-CLIP	23446348
MIRT505417	hsa-miR-4793-3p	PAR-CLIP	23446348
MIRT505416	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT505415	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT505414	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT505413	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT505412	hsa-miR-1298-5p	PAR-CLIP	23446348
MIRT505411	hsa-miR-4435	PAR-CLIP	23446348
MIRT736693	hsa-miR-26b-5p	Luciferase reporter assayWestern blottingImmunofluorescence	32579400
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT641843	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT641842	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT641841	hsa-miR-6768-3p	HITS-CLIP	23824327
MIRT641840	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT641839	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT641838	hsa-miR-3938	HITS-CLIP	23824327
MIRT641837	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT641836	hsa-miR-623	HITS-CLIP	23824327
MIRT641835	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT641834	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT621862	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT261341	hsa-miR-8063	HITS-CLIP	23824327
MIRT261338	hsa-miR-4698	HITS-CLIP	23824327
MIRT621858	hsa-miR-1305	HITS-CLIP	23824327
MIRT621862	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT621861	hsa-miR-8485	HITS-CLIP	23824327
MIRT621860	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT621859	hsa-miR-421	HITS-CLIP	23824327
MIRT621858	hsa-miR-1305	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT261349	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT261342	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT261347	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT553717	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT553716	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT553715	hsa-miR-4295	PAR-CLIP	21572407
MIRT553714	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT553713	hsa-miR-3666	PAR-CLIP	21572407
MIRT553712	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT553711	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT553710	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT553709	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT553708	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT553707	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT553706	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT553705	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT553704	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT553703	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT553702	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT553701	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT553700	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT553698	hsa-miR-4759	PAR-CLIP	21572407
MIRT553699	hsa-miR-3169	PAR-CLIP	21572407
MIRT553697	hsa-miR-8083	PAR-CLIP	21572407
MIRT261354	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT553696	hsa-miR-5193	PAR-CLIP	21572407
MIRT553695	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT553694	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT553693	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT553692	hsa-miR-891b	PAR-CLIP	21572407
MIRT553691	hsa-miR-3117-3p	PAR-CLIP	21572407
MIRT553690	hsa-miR-651-5p	PAR-CLIP	21572407
MIRT505430	hsa-miR-200b-3p	PAR-CLIP	21572407
MIRT505429	hsa-miR-200c-3p	PAR-CLIP	21572407
MIRT505428	hsa-miR-429	PAR-CLIP	21572407
MIRT505427	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT505426	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT505425	hsa-miR-1-5p	PAR-CLIP	21572407
MIRT505424	hsa-miR-4418	PAR-CLIP	21572407
MIRT505423	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT505422	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT505421	hsa-miR-217	PAR-CLIP	21572407
MIRT505420	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT505419	hsa-miR-892b	PAR-CLIP	21572407
MIRT505418	hsa-miR-3919	PAR-CLIP	21572407
MIRT505416	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT505415	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT505414	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT505413	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT505412	hsa-miR-1298-5p	PAR-CLIP	21572407
MIRT505411	hsa-miR-4435	PAR-CLIP	21572407
MIRT505430	hsa-miR-200b-3p	PAR-CLIP	23446348
MIRT505429	hsa-miR-200c-3p	PAR-CLIP	23446348
MIRT505428	hsa-miR-429	PAR-CLIP	23446348
MIRT505427	hsa-miR-193b-3p	PAR-CLIP	23446348
MIRT505426	hsa-miR-193a-3p	PAR-CLIP	23446348
MIRT505425	hsa-miR-1-5p	PAR-CLIP	23446348
MIRT505424	hsa-miR-4418	PAR-CLIP	23446348
MIRT505423	hsa-miR-509-3-5p	PAR-CLIP	23446348
MIRT505422	hsa-miR-509-5p	PAR-CLIP	23446348
MIRT505421	hsa-miR-217	PAR-CLIP	23446348
MIRT505420	hsa-miR-6807-3p	PAR-CLIP	23446348
MIRT505419	hsa-miR-892b	PAR-CLIP	23446348
MIRT505418	hsa-miR-3919	PAR-CLIP	23446348
MIRT505417	hsa-miR-4793-3p	PAR-CLIP	23446348
MIRT505416	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT505415	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT505414	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT505413	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT505412	hsa-miR-1298-5p	PAR-CLIP	23446348
MIRT505411	hsa-miR-4435	PAR-CLIP	23446348
MIRT756266	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingqRT-PCR	38372101
MIRT1416457	hsa-miR-1264	CLIP-seq
MIRT1416458	hsa-miR-1271	CLIP-seq
MIRT1416459	hsa-miR-1272	CLIP-seq
MIRT1416460	hsa-miR-1297	CLIP-seq
MIRT1416461	hsa-miR-182	CLIP-seq
MIRT1416462	hsa-miR-193b	CLIP-seq
MIRT1416463	hsa-miR-194	CLIP-seq
MIRT1416464	hsa-miR-216b	CLIP-seq
MIRT1416465	hsa-miR-26a	CLIP-seq
MIRT1416466	hsa-miR-26b	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416468	hsa-miR-3136-3p	CLIP-seq
MIRT1416469	hsa-miR-3675-3p	CLIP-seq
MIRT1416470	hsa-miR-380	CLIP-seq
MIRT1416471	hsa-miR-3942-5p	CLIP-seq
MIRT1416472	hsa-miR-4251	CLIP-seq
MIRT1416473	hsa-miR-4420	CLIP-seq
MIRT1416474	hsa-miR-4422	CLIP-seq
MIRT1416475	hsa-miR-4465	CLIP-seq
MIRT1416476	hsa-miR-4495	CLIP-seq
MIRT1416477	hsa-miR-4509	CLIP-seq
MIRT1416478	hsa-miR-4703-5p	CLIP-seq
MIRT1416479	hsa-miR-4744	CLIP-seq
MIRT1416480	hsa-miR-498	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT1416483	hsa-miR-545	CLIP-seq
MIRT1416484	hsa-miR-548p	CLIP-seq
MIRT1416485	hsa-miR-561	CLIP-seq
MIRT1416486	hsa-miR-564	CLIP-seq
MIRT1416487	hsa-miR-580	CLIP-seq
MIRT1416488	hsa-miR-642a	CLIP-seq
MIRT1416489	hsa-miR-96	CLIP-seq
MIRT1416490	hsa-miR-1237	CLIP-seq
MIRT1416491	hsa-miR-1248	CLIP-seq
MIRT1416492	hsa-miR-1283	CLIP-seq
MIRT1416493	hsa-miR-1299	CLIP-seq
MIRT1416494	hsa-miR-183	CLIP-seq
MIRT1416463	hsa-miR-194	CLIP-seq
MIRT1416495	hsa-miR-2054	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416496	hsa-miR-3686	CLIP-seq
MIRT1416497	hsa-miR-369-3p	CLIP-seq
MIRT1416498	hsa-miR-374c	CLIP-seq
MIRT1416470	hsa-miR-380	CLIP-seq
MIRT1416499	hsa-miR-4310	CLIP-seq
MIRT1416476	hsa-miR-4495	CLIP-seq
MIRT1416500	hsa-miR-450b-5p	CLIP-seq
MIRT1416501	hsa-miR-4517	CLIP-seq
MIRT1416502	hsa-miR-4636	CLIP-seq
MIRT1416503	hsa-miR-4652-3p	CLIP-seq
MIRT1416504	hsa-miR-4721	CLIP-seq
MIRT1416505	hsa-miR-4782-5p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT1416507	hsa-miR-505	CLIP-seq
MIRT1416508	hsa-miR-507	CLIP-seq
MIRT1416509	hsa-miR-516b	CLIP-seq
MIRT1416510	hsa-miR-520d-5p	CLIP-seq
MIRT1416511	hsa-miR-524-5p	CLIP-seq
MIRT1416483	hsa-miR-545	CLIP-seq
MIRT1416484	hsa-miR-548p	CLIP-seq
MIRT1416512	hsa-miR-548u	CLIP-seq
MIRT1416513	hsa-miR-557	CLIP-seq
MIRT1416514	hsa-miR-655	CLIP-seq
MIRT1416515	hsa-miR-155	CLIP-seq
MIRT1416516	hsa-miR-2053	CLIP-seq
MIRT1416517	hsa-miR-330-3p	CLIP-seq
MIRT1416518	hsa-miR-3609	CLIP-seq
MIRT1416519	hsa-miR-4261	CLIP-seq
MIRT1416520	hsa-miR-4643	CLIP-seq
MIRT1416521	hsa-miR-466	CLIP-seq
MIRT1416522	hsa-miR-4781-5p	CLIP-seq
MIRT1416523	hsa-miR-4789-3p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT1416524	hsa-miR-494	CLIP-seq
MIRT1416525	hsa-miR-503	CLIP-seq
MIRT1416526	hsa-miR-548aa	CLIP-seq
MIRT1416527	hsa-miR-548ah	CLIP-seq
MIRT1416528	hsa-miR-548t	CLIP-seq
MIRT1416529	hsa-miR-569	CLIP-seq
MIRT1416530	hsa-miR-624	CLIP-seq
MIRT1416531	hsa-miR-656	CLIP-seq
MIRT2124906	hsa-miR-1258	CLIP-seq
MIRT1416494	hsa-miR-183	CLIP-seq
MIRT2124907	hsa-miR-1910	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT2124908	hsa-miR-337-5p	CLIP-seq
MIRT2124909	hsa-miR-3658	CLIP-seq
MIRT2124910	hsa-miR-377	CLIP-seq
MIRT1416499	hsa-miR-4310	CLIP-seq
MIRT2124911	hsa-miR-4485	CLIP-seq
MIRT2124912	hsa-miR-455-3p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT1416480	hsa-miR-498	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT1416507	hsa-miR-505	CLIP-seq
MIRT1416485	hsa-miR-561	CLIP-seq
MIRT2124913	hsa-miR-602	CLIP-seq
MIRT2124914	hsa-miR-802	CLIP-seq
MIRT2124906	hsa-miR-1258	CLIP-seq
MIRT1416458	hsa-miR-1271	CLIP-seq
MIRT1416459	hsa-miR-1272	CLIP-seq
MIRT2347317	hsa-miR-181a	CLIP-seq
MIRT2347318	hsa-miR-181b	CLIP-seq
MIRT2347319	hsa-miR-181c	CLIP-seq
MIRT2347320	hsa-miR-181d	CLIP-seq
MIRT1416461	hsa-miR-182	CLIP-seq
MIRT1416494	hsa-miR-183	CLIP-seq
MIRT2124907	hsa-miR-1910	CLIP-seq
MIRT1416463	hsa-miR-194	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT2347321	hsa-miR-3156-3p	CLIP-seq
MIRT2347322	hsa-miR-3192	CLIP-seq
MIRT1416470	hsa-miR-380	CLIP-seq
MIRT2347323	hsa-miR-3973	CLIP-seq
MIRT1416472	hsa-miR-4251	CLIP-seq
MIRT1416519	hsa-miR-4261	CLIP-seq
MIRT2347324	hsa-miR-4262	CLIP-seq
MIRT2347325	hsa-miR-4301	CLIP-seq
MIRT1416473	hsa-miR-4420	CLIP-seq
MIRT2347326	hsa-miR-4426	CLIP-seq
MIRT2347327	hsa-miR-4436b-3p	CLIP-seq
MIRT2347328	hsa-miR-4447	CLIP-seq
MIRT2347329	hsa-miR-4472	CLIP-seq
MIRT2347330	hsa-miR-4477a	CLIP-seq
MIRT1416476	hsa-miR-4495	CLIP-seq
MIRT2347331	hsa-miR-4496	CLIP-seq
MIRT2124912	hsa-miR-455-3p	CLIP-seq
MIRT2347332	hsa-miR-4647	CLIP-seq
MIRT2347333	hsa-miR-4651	CLIP-seq
MIRT2347334	hsa-miR-4662b	CLIP-seq
MIRT2347335	hsa-miR-4717-3p	CLIP-seq
MIRT2347336	hsa-miR-4761-3p	CLIP-seq
MIRT2347337	hsa-miR-4761-5p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT1416524	hsa-miR-494	CLIP-seq
MIRT1416480	hsa-miR-498	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT2347338	hsa-miR-520g	CLIP-seq
MIRT2347339	hsa-miR-520h	CLIP-seq
MIRT2347340	hsa-miR-543	CLIP-seq
MIRT1416483	hsa-miR-545	CLIP-seq
MIRT2347341	hsa-miR-548a-3p	CLIP-seq
MIRT2347342	hsa-miR-548e	CLIP-seq
MIRT2347343	hsa-miR-548f	CLIP-seq
MIRT2347344	hsa-miR-548l	CLIP-seq
MIRT1416484	hsa-miR-548p	CLIP-seq
MIRT1416485	hsa-miR-561	CLIP-seq
MIRT1416486	hsa-miR-564	CLIP-seq
MIRT1416487	hsa-miR-580	CLIP-seq
MIRT2124913	hsa-miR-602	CLIP-seq
MIRT2347345	hsa-miR-608	CLIP-seq
MIRT2124914	hsa-miR-802	CLIP-seq
MIRT1416489	hsa-miR-96	CLIP-seq
MIRT1416494	hsa-miR-183	CLIP-seq
MIRT2124907	hsa-miR-1910	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416499	hsa-miR-4310	CLIP-seq
MIRT2124912	hsa-miR-455-3p	CLIP-seq
MIRT2395593	hsa-miR-4686	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT2124913	hsa-miR-602	CLIP-seq
MIRT2640313	hsa-miR-1183	CLIP-seq
MIRT2124906	hsa-miR-1258	CLIP-seq
MIRT1416459	hsa-miR-1272	CLIP-seq
MIRT2640314	hsa-miR-135a	CLIP-seq
MIRT2640315	hsa-miR-135b	CLIP-seq
MIRT2347317	hsa-miR-181a	CLIP-seq
MIRT2347318	hsa-miR-181b	CLIP-seq
MIRT2347319	hsa-miR-181c	CLIP-seq
MIRT2347320	hsa-miR-181d	CLIP-seq
MIRT2640316	hsa-miR-191	CLIP-seq
MIRT1416463	hsa-miR-194	CLIP-seq
MIRT2640317	hsa-miR-2115	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT2640318	hsa-miR-3133	CLIP-seq
MIRT2640319	hsa-miR-3135	CLIP-seq
MIRT1416468	hsa-miR-3136-3p	CLIP-seq
MIRT2640320	hsa-miR-3591-3p	CLIP-seq
MIRT2640321	hsa-miR-3646	CLIP-seq
MIRT2640322	hsa-miR-3662	CLIP-seq
MIRT2640323	hsa-miR-3673	CLIP-seq
MIRT1416470	hsa-miR-380	CLIP-seq
MIRT2640324	hsa-miR-3913-3p	CLIP-seq
MIRT2347323	hsa-miR-3973	CLIP-seq
MIRT1416519	hsa-miR-4261	CLIP-seq
MIRT2347324	hsa-miR-4262	CLIP-seq
MIRT1416499	hsa-miR-4310	CLIP-seq
MIRT2640325	hsa-miR-4419a	CLIP-seq
MIRT1416473	hsa-miR-4420	CLIP-seq
MIRT2640326	hsa-miR-4464	CLIP-seq
MIRT2347330	hsa-miR-4477a	CLIP-seq
MIRT1416476	hsa-miR-4495	CLIP-seq
MIRT2347331	hsa-miR-4496	CLIP-seq
MIRT1416500	hsa-miR-450b-5p	CLIP-seq
MIRT2640327	hsa-miR-4510	CLIP-seq
MIRT2640328	hsa-miR-4719	CLIP-seq
MIRT2640329	hsa-miR-4729	CLIP-seq
MIRT2640330	hsa-miR-4748	CLIP-seq
MIRT2640331	hsa-miR-4762-5p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT2640332	hsa-miR-489	CLIP-seq
MIRT1416524	hsa-miR-494	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT1416508	hsa-miR-507	CLIP-seq
MIRT2640333	hsa-miR-513b	CLIP-seq
MIRT1416510	hsa-miR-520d-5p	CLIP-seq
MIRT2347338	hsa-miR-520g	CLIP-seq
MIRT2347339	hsa-miR-520h	CLIP-seq
MIRT1416511	hsa-miR-524-5p	CLIP-seq
MIRT2347340	hsa-miR-543	CLIP-seq
MIRT1416483	hsa-miR-545	CLIP-seq
MIRT2347341	hsa-miR-548a-3p	CLIP-seq
MIRT2640334	hsa-miR-548ad	CLIP-seq
MIRT2640335	hsa-miR-548c-3p	CLIP-seq
MIRT2347342	hsa-miR-548e	CLIP-seq
MIRT2347343	hsa-miR-548f	CLIP-seq
MIRT2347344	hsa-miR-548l	CLIP-seq
MIRT1416484	hsa-miR-548p	CLIP-seq
MIRT1416513	hsa-miR-557	CLIP-seq
MIRT2640336	hsa-miR-583	CLIP-seq
MIRT2640337	hsa-miR-595	CLIP-seq
MIRT2640338	hsa-miR-629	CLIP-seq
MIRT2640339	hsa-miR-664	CLIP-seq
MIRT2124914	hsa-miR-802	CLIP-seq
MIRT2640340	hsa-miR-890	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416519	hsa-miR-4261	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
AR	Unknown	12799378
FOXA2	Unknown	22951069
GATA3	Unknown	22951069
HNF4A	Unknown	22951069
TP53	Repression	14990988

Show/Hide all (66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12799378
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	19443654
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	20128911
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19443654
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	19443654
GO:0001222	Function	Transcription corepressor binding	IPI	19443654
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12799378
GO:0001568	Process	Blood vessel development	IMP	15578569
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9727977
GO:0005515	Function	Protein binding	IPI	11713475, 11713476, 16442529, 16569639, 16724116, 17283121, 17873903, 18193033, 18772112, 19202075, 19304756, 19816403, 20126258, 22014570, 22056988, 22304967, 24589551, 28829046, 30833792, 32296183
GO:0005634	Component	Nucleus	IDA	9065401, 16532032, 19304756, 19386626
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	19168596
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9727977
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008013	Function	Beta-catenin binding	EXP	11713476
GO:0008013	Function	Beta-catenin binding	IDA	9065401
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008013	Function	Beta-catenin binding	IPI	11237626, 12408825, 19443654
GO:0009749	Process	Response to glucose	ISS	19168596
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	17072303
GO:0010909	Process	Positive regulation of heparan sulfate proteoglycan biosynthetic process	IMP	15853773
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016605	Component	PML body	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	12799378
GO:0019901	Function	Protein kinase binding	IPI	16714285
GO:0031016	Process	Pancreas development	TAS	18216022
GO:0032024	Process	Positive regulation of insulin secretion	IMP	19386626
GO:0032350	Process	Regulation of hormone metabolic process	IDA	15525634
GO:0032993	Component	Protein-DNA complex	IDA	14661054
GO:0042593	Process	Glucose homeostasis	IDA	15525634
GO:0043565	Function	Sequence-specific DNA binding	IDA	14661054
GO:0043565	Function	Sequence-specific DNA binding	IMP	16532032
GO:0043570	Process	Maintenance of DNA repeat elements	IMP	18755497
GO:0045295	Function	Gamma-catenin binding	IPI	14661054
GO:0045444	Process	Fat cell differentiation	IDA	10937998
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15525634
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16532032
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9065401, 19168596, 19443654
GO:0048625	Process	Myoblast fate commitment	IDA	10937998
GO:0048660	Process	Regulation of smooth muscle cell proliferation	IMP	17122440
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	12408868
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19386626
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IC	9065401
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	12408825, 19443654
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	17072303
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IDA	12799378
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16007074, 16434966, 17875931
GO:0070016	Function	Armadillo repeat domain binding	IPI	12408825
GO:0070369	Component	Beta-catenin-TCF7L2 complex	IDA	9065401, 9065402
GO:0071664	Component	Catenin-TCF7L2 complex	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	16532032
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	19386626
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:1990907	Component	Beta-catenin-TCF complex	IBA
GO:2000675	Process	Negative regulation of type B pancreatic cell apoptotic process	ISS
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
602228	11641	ENSG00000148737

Q9NQB0

Protein name

Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)

Protein function

Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as a repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promote

PDB

1JDH , 1JPW , 2GL7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08347	CTNNB1_binding	1 → 259	N-terminal CTNNB1 binding	Family
PF00505	HMG_box	350 → 418	HMG (high mobility group) box	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland an

Sequence

MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPC
RRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKP
DPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSH
SSLAGTQPQPLSLVTKSLE

Sequence length

619

Interactions

View interactions

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autism	Pathogenic	rs2137155220	RCV003223494
Neurodevelopmental abnormality	Likely pathogenic	rs2137178800	RCV001754559
Neurodevelopmental delay	Likely pathogenic	rs2136929776	RCV002274381

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs72828146	RCV005923689
Diabetes mellitus type 2, susceptibility to	risk factor	rs7903146, rs12255372, rs11196205	RCV000007838 RCV000007839 RCV000007840
Intellectual disability	Uncertain significance	rs766204038	RCV003458321
TCF7L2-related disorder	Likely benign; Benign; Uncertain significance	rs377724519, rs1173115336, rs138649767, rs140603697, rs753753787, rs375945855, rs762632915, rs369811726, rs147601829	RCV003953980 RCV003954114 RCV003979681 RCV003914181 RCV003944315 RCV003964745 RCV003969826 RCV003910635 RCV003933067
TCF7L2-related Intellectual disability	Uncertain significance	rs2137177533	RCV002266716
TCF7L2-relatedIntellectual disability	Uncertain significance	rs368705098	RCV004799349
Type 2 diabetes mellitus	Uncertain significance	rs1396649788	RCV004577656
Uterine corpus endometrial carcinoma	Benign	rs72828146	RCV005923690

Show/Hide Text Mining Associations (134)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Coronary Syndrome	Associate	40303486
Adenocarcinoma	Associate	31211453
Adenoma	Associate	18478343, 27221540, 27769063
Adenomatous Polyposis Coli	Associate	15972967, 32170005
Alzheimer Disease	Associate	38458367
Angina Stable	Associate	40303486
Aortic Aneurysm Thoracic	Associate	34265237
Arthritis Rheumatoid	Associate	12428226
Atherosclerosis	Associate	18437354, 24371822
Atherosclerosis	Inhibit	40303486
Attention Deficit Disorder with Hyperactivity	Associate	34003604
Autistic Disorder	Associate	34003604
Barrett Esophagus	Associate	35654816
Bipolar Disorder	Associate	34535768
Blast Crisis	Associate	32517078
Breast Neoplasms	Associate	17109766, 18302196, 19732438, 22318732, 23085767, 23516639, 23914993, 24325915, 27053251, 27738320, 28351929, 28791367, 34340678, 35996498
Breast Neoplasms	Inhibit	24338422
Calcinosis Cutis	Associate	28351929
Carbohydrate Metabolism Inborn Errors	Associate	35292917
Carcinogenesis	Associate	28117551, 32203164, 36609428
Carcinoma Hepatocellular	Associate	12378619, 21256126, 23562475, 23651211, 29620186
Carcinoma Renal Cell	Associate	39366533
Cardio Renal Syndrome	Associate	29182660
Cardiomyopathy Restrictive	Associate	18239663
Cardiovascular Diseases	Associate	19141698, 22712642, 23942586, 24574000, 25353718
Cognitive Dysfunction	Associate	17661009, 38065904
Colonic Neoplasms	Associate	21892161, 22402060
Colorectal Neoplasms	Associate	15928669, 18268006, 18268068, 18398040, 18478343, 18621708, 21892161, 23629434, 24317174, 24338422, 24608966, 25617745, 25961950, 26474385, 27221540 View all (18 more)
Coronary Artery Disease	Associate	19924244, 21423583, 24098343, 28595632, 33752320, 39600283, 40303486, 40485517
Coronary Disease	Associate	19055834, 33122478
Crohn Disease	Associate	19221600, 22393312
Cystic Fibrosis	Associate	19585101, 23050589, 31697830
Dementia	Associate	17181866
Depressive Disorder	Associate	36734726
Depressive Disorder Major	Associate	36734726
Developmental Disabilities	Associate	34003604
Diabetes Complications	Associate	33752320
Diabetes Gestational	Associate	17317761, 17342473, 20540670, 20682688, 21672010, 22480428, 25973943, 27173344, 27465520, 28072873, 28133617, 28699988, 29947923, 30614312, 33352264 View all (4 more)
Diabetes Mellitus	Associate	16855264, 17181866, 17317761, 17671643, 17697858, 17903298, 18268068, 18302196, 18398040, 18437354, 18650481, 18719881, 18931037, 19050058, 19055834 View all (53 more)
Diabetes Mellitus	Stimulate	29135090
Diabetes Mellitus Insulin Dependent 19	Associate	19713311, 24128935, 33641658
Diabetes Mellitus Type 1	Associate	29025879, 30275285, 30467975, 31167894, 33352264, 34326068, 36282337, 36300877
Diabetes Mellitus Type 2	Associate	16855264, 17020404, 17109766, 17181866, 17245589, 17317761, 17416797, 17463248, 17503332, 17593304, 17653210, 17661009, 17668382, 17671643, 17671651 View all (223 more)
Diabetes Mellitus Type 2	Stimulate	19033397, 19368707, 21873549, 23527042, 24376643, 24953961, 33752320
Diabetic Nephropathies	Associate	17653210, 24574000, 24864085, 30290587, 38189041
Diabetic Neuropathies	Associate	27253191
Diabetic Retinopathy	Associate	25274455, 35677638
Duane Retraction Syndrome	Associate	35677638
Dyslipidemias	Associate	19141698, 35341056, 40225014
Endometriosis	Associate	27055116
Esophageal Neoplasms	Associate	28536608, 35484214
Esophageal Squamous Cell Carcinoma	Associate	28536608
Exostoses Multiple Hereditary	Associate	25498973
Fibrolamellar hepatocellular carcinoma	Associate	36000549
Gardner Syndrome	Associate	33787608
Genetic Diseases Inborn	Associate	38492821
Glucose Intolerance	Associate	16855264, 17593304, 19258437, 19351735, 23456907, 24062323, 24205231, 28183453, 28611053, 30614312, 31972003, 32788279, 33352264, 35477971
Glucose Metabolism Disorders	Associate	22296403, 27377425
Hernias Diaphragmatic Congenital	Associate	22071887
Hyperglycemia	Associate	19864407, 20185807, 20299486, 20682688, 26367734, 32182220
Hyperinsulinism	Associate	20185807
Hyperlipidemias	Associate	19141698, 22916254
Hypersensitivity Immediate	Associate	17206141
Hypertension	Associate	23942764, 33752320, 34001234, 37816730
Hypertensive Retinopathy	Associate	17181866
Hypoglycemia	Associate	17181866, 19864407, 20299486, 20578204, 33352264
Hypoxia	Stimulate	35484214
Idiopathic Noncirrhotic Portal Hypertension	Associate	32651957
Ileal Diseases	Associate	19221600
Inflammation	Associate	40303486
Insulin Resistance	Associate	17317761, 17671651, 19351735, 20032493, 20107109, 22301903, 25274455, 26087292, 26634513, 27998387, 28183453, 31070566, 32651957, 39600283
Insulinoma	Associate	32182220, 32788279, 37107681
Intellectual Disability	Associate	34003604
Ischemic Attack Transient	Associate	21921652
Islet cell tumor syndrome	Associate	30275285
Kidney Diseases	Associate	18650481, 33752320
Kidney Failure Chronic	Associate	24574000
Latent Autoimmune Diabetes in Adults	Associate	30656477, 31125083
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	32517078
Leukemia Myeloid Acute	Associate	32068780
Leukemia Myeloid Acute	Stimulate	32517078
Lung Neoplasms	Associate	18268068, 26535715, 26823848
Lymphatic Metastasis	Associate	31211453
Lymphoma Non Hodgkin	Associate	37828118
Mason Type Diabetes	Associate	33352264
Maturity Onset Diabetes of the Young Type 2	Associate	33352264
Mental Disorders	Associate	32788279, 36734726
Metabolic Diseases	Associate	22904171, 24205231
Metabolic Syndrome	Associate	17181866, 19141698, 25353718, 33352264, 36263318, 37816730
Microsatellite Instability	Associate	17659738
Muscular Dystrophy Duchenne	Associate	30172742
Musculoskeletal Diseases	Associate	34003604
Myocardial Infarction	Associate	17181866
Myopia	Associate	34003604
Neoplasm Metastasis	Associate	35864968, 38492821
Neoplasms	Associate	11931652, 12378619, 17109766, 18302196, 18621708, 18992263, 19561607, 21059207, 22951069, 23629434, 24943349, 25519018, 27221540, 27738320, 30548288 View all (7 more)
Neoplasms	Stimulate	32068780
Neoplasms	Inhibit	32203164
Neoplasms Adipose Tissue	Associate	17317761, 23034957, 34872092
Neural Tube Defects	Associate	23132673
Neuroblastoma	Associate	33000697
Obesity	Associate	18059616, 18239663, 18469204, 18931037, 19056611, 19183934, 19526209, 20032493, 20097709, 20578204, 21707949, 21921652, 23132673, 23626757, 23825961 View all (24 more)
Obesity	Inhibit	35697299
Obesity Abdominal	Associate	27998387, 34340678, 40225014
Osteoporosis	Associate	30172742
Osteosarcoma	Associate	38254188
Ovarian Neoplasms	Associate	36721777
Overweight	Associate	23349771, 30275285, 31125083
Pancreatic Neoplasms	Associate	29476053, 30548288
Pancreatitis	Associate	18706099
Parkinson Disease	Associate	36869069
Peripheral Arterial Disease	Associate	31775533
Plagiocephaly and X linked mental retardation	Associate	34003604
Polycystic Ovary Syndrome	Associate	18958766, 19351735, 22296403, 22301903, 22904171, 37606143
Prediabetic State	Associate	28611053, 31972003, 33761736, 36263318
Propping Zerres syndrome	Associate	29458357
Prostatic Neoplasms	Associate	18302196, 20142250, 23193118, 25678841
Psoriasis	Associate	31089877
Psychotic Disorders	Associate	19643578
Pyruvate Carboxylase Deficiency Disease	Associate	22393312
Rectal Neoplasms	Associate	17659738, 21983179, 25519018, 28811361
Renal Insufficiency Chronic	Associate	18650481
Schizophrenia	Associate	22247771
Scleroderma Systemic	Associate	37587067
Sleep Apnea Obstructive	Associate	30600310
Squamous Cell Carcinoma of Head and Neck	Associate	33723940
Stomach Neoplasms	Associate	27605886, 35864968
Stroke	Associate	21921652, 23942586
Thyroid Cancer Papillary	Associate	33371788
Triple Negative Breast Neoplasms	Associate	24325915, 37306188
Tropical Calcific Pancreatitis	Associate	18706099
Uterine Cervical Neoplasms	Associate	28165569
Weight Gain	Associate	19864407, 25099543
Weight Loss	Associate	20028944, 20032493, 21814547, 23034957

TCF7L2 (transcription factor 7 like 2)