Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83439
Gene name Gene Name - the full gene name approved by the HGNC.
Transcription factor 7 like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TCF7L1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor be
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016640 hsa-miR-429 Reporter assay 20005803
MIRT020351 hsa-miR-200a-3p Reporter assay 20005803
MIRT021073 hsa-miR-200c-3p Reporter assay 20005803
MIRT021652 hsa-miR-141-3p Reporter assay 20005803
MIRT024127 hsa-miR-200b-3p Reporter assay 20005803
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003677 Function DNA binding NAS 1741298, 11085512
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604652 11640 ENSG00000152284
Protein
UniProt ID Q9HCS4
Protein name Transcription factor 7-like 1 (HMG box transcription factor 3) (TCF-3)
Protein function Participates in the Wnt signaling pathway. Binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. Necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08347 CTNNB1_binding 1 250 N-terminal CTNNB1 binding Family
PF00505 HMG_box 346 414 HMG (high mobility group) box Domain
Tissue specificity TISSUE SPECIFICITY: Detected in hair follicles and skin keratinocytes, and at lower levels in stomach epithelium. {ECO:0000269|PubMed:9916915}.
Sequence
MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
DLDEVKSSLVNESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP
GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
VVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGA
VGQIPHPLGW
LVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWS
ARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
LLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH
Sequence length 588
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cervical Cancer Cervical cancer N/A N/A GWAS
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bantu siderosis Associate 18840782
Bladder Exstrophy Associate 39500676
Carcinoma Hepatocellular Associate 29658607
Colonic Neoplasms Associate 36181111
Colorectal Neoplasms Associate 36105798, 36833408, 38224823
Diabetes Mellitus Type 2 Associate 18840782
Lung Neoplasms Associate 37307368
Mesothelioma Associate 35127947
Neoplasms Stimulate 30811526
Pulmonary Disease Chronic Obstructive Inhibit 21490961