Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6932
Gene name Gene Name - the full gene name approved by the HGNC.	Transcription factor 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TCF7
Synonyms (NCBI Gene) Gene synonyms aliases	TCF-1
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the T-cell factor/lymphoid enhancer-binding factor family of high mobility group (HMG) box transcriptional activators. This gene is expressed predominantly in T-cells and plays a critical role in natural killer cell and innat

Show/Hide all(135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024837	hsa-miR-215-5p	Microarray	19074876
MIRT026207	hsa-miR-192-5p	Microarray	19074876
MIRT731117	hsa-miR-34a-5p	qRT-PCR, Luciferase reporter assay, Immunohistochemistry, Western blot	25436980
MIRT731117	hsa-miR-34a-5p	qRT-PCR, Luciferase reporter assay, Immunohistochemistry, Western blot	25436980
MIRT731389	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	26193896
MIRT755362	hsa-miR-491-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36988257
MIRT1416377	hsa-miR-127-5p	CLIP-seq
MIRT1416378	hsa-miR-197	CLIP-seq
MIRT1416379	hsa-miR-24	CLIP-seq
MIRT1416380	hsa-miR-296-3p	CLIP-seq
MIRT1416381	hsa-miR-3187-3p	CLIP-seq
MIRT1416382	hsa-miR-3613-3p	CLIP-seq
MIRT1416383	hsa-miR-3663-5p	CLIP-seq
MIRT1416384	hsa-miR-3688-5p	CLIP-seq
MIRT1416385	hsa-miR-371-5p	CLIP-seq
MIRT1416386	hsa-miR-371b-5p	CLIP-seq
MIRT1416387	hsa-miR-4284	CLIP-seq
MIRT1416388	hsa-miR-4435	CLIP-seq
MIRT1416389	hsa-miR-4453	CLIP-seq
MIRT1416390	hsa-miR-4457	CLIP-seq
MIRT1416391	hsa-miR-4470	CLIP-seq
MIRT1416392	hsa-miR-4538	CLIP-seq
MIRT1416393	hsa-miR-4691-3p	CLIP-seq
MIRT1416394	hsa-miR-4701-5p	CLIP-seq
MIRT1416395	hsa-miR-4716-5p	CLIP-seq
MIRT1416396	hsa-miR-4755-3p	CLIP-seq
MIRT1416397	hsa-miR-4761-5p	CLIP-seq
MIRT1416398	hsa-miR-4781-3p	CLIP-seq
MIRT1416399	hsa-miR-5096	CLIP-seq
MIRT1416400	hsa-miR-548s	CLIP-seq
MIRT1416401	hsa-miR-588	CLIP-seq
MIRT1416402	hsa-miR-606	CLIP-seq
MIRT1416403	hsa-miR-624	CLIP-seq
MIRT1416404	hsa-miR-1178	CLIP-seq
MIRT1416405	hsa-miR-125a-3p	CLIP-seq
MIRT1416406	hsa-miR-1273f	CLIP-seq
MIRT1416407	hsa-miR-129-5p	CLIP-seq
MIRT1416408	hsa-miR-143	CLIP-seq
MIRT1416409	hsa-miR-1914	CLIP-seq
MIRT1416378	hsa-miR-197	CLIP-seq
MIRT1416410	hsa-miR-2113	CLIP-seq
MIRT1416411	hsa-miR-218	CLIP-seq
MIRT1416412	hsa-miR-3144-5p	CLIP-seq
MIRT1416413	hsa-miR-3149	CLIP-seq
MIRT1416381	hsa-miR-3187-3p	CLIP-seq
MIRT1416414	hsa-miR-3191	CLIP-seq
MIRT1416415	hsa-miR-339-5p	CLIP-seq
MIRT1416383	hsa-miR-3663-5p	CLIP-seq
MIRT1416385	hsa-miR-371-5p	CLIP-seq
MIRT1416386	hsa-miR-371b-5p	CLIP-seq
MIRT1416416	hsa-miR-3934	CLIP-seq
MIRT1416417	hsa-miR-3935	CLIP-seq
MIRT1416418	hsa-miR-411	CLIP-seq
MIRT1416419	hsa-miR-4287	CLIP-seq
MIRT1416388	hsa-miR-4435	CLIP-seq
MIRT1416420	hsa-miR-4469	CLIP-seq
MIRT1416421	hsa-miR-4487	CLIP-seq
MIRT1416422	hsa-miR-4532	CLIP-seq
MIRT1416423	hsa-miR-4652-5p	CLIP-seq
MIRT1416424	hsa-miR-4667-5p	CLIP-seq
MIRT1416425	hsa-miR-4685-3p	CLIP-seq
MIRT1416426	hsa-miR-4700-5p	CLIP-seq
MIRT1416394	hsa-miR-4701-5p	CLIP-seq
MIRT1416427	hsa-miR-4708-5p	CLIP-seq
MIRT1416395	hsa-miR-4716-5p	CLIP-seq
MIRT1416428	hsa-miR-4717-5p	CLIP-seq
MIRT1416429	hsa-miR-4731-5p	CLIP-seq
MIRT1416430	hsa-miR-4735-5p	CLIP-seq
MIRT1416396	hsa-miR-4755-3p	CLIP-seq
MIRT1416431	hsa-miR-4763-5p	CLIP-seq
MIRT1416432	hsa-miR-4770	CLIP-seq
MIRT1416433	hsa-miR-4775	CLIP-seq
MIRT1416398	hsa-miR-4781-3p	CLIP-seq
MIRT1416434	hsa-miR-4783-5p	CLIP-seq
MIRT1416435	hsa-miR-486-3p	CLIP-seq
MIRT1416399	hsa-miR-5096	CLIP-seq
MIRT1416400	hsa-miR-548s	CLIP-seq
MIRT1416436	hsa-miR-550a	CLIP-seq
MIRT1416401	hsa-miR-588	CLIP-seq
MIRT1416437	hsa-miR-590-3p	CLIP-seq
MIRT1416438	hsa-miR-591	CLIP-seq
MIRT1416402	hsa-miR-606	CLIP-seq
MIRT1416439	hsa-miR-636	CLIP-seq
MIRT1416440	hsa-miR-640	CLIP-seq
MIRT1416441	hsa-miR-758	CLIP-seq
MIRT1416442	hsa-miR-764	CLIP-seq
MIRT1416443	hsa-miR-3545-3p	CLIP-seq
MIRT1416444	hsa-miR-3921	CLIP-seq
MIRT1416445	hsa-miR-4251	CLIP-seq
MIRT1416446	hsa-miR-4329	CLIP-seq
MIRT1416447	hsa-miR-4421	CLIP-seq
MIRT1416448	hsa-miR-4653-5p	CLIP-seq
MIRT1416428	hsa-miR-4717-5p	CLIP-seq
MIRT1416449	hsa-miR-593	CLIP-seq
MIRT1416424	hsa-miR-4667-5p	CLIP-seq
MIRT1416426	hsa-miR-4700-5p	CLIP-seq
MIRT2640247	hsa-miR-1224-3p	CLIP-seq
MIRT2640248	hsa-miR-1260	CLIP-seq
MIRT2640249	hsa-miR-1260b	CLIP-seq
MIRT2640250	hsa-miR-1280	CLIP-seq
MIRT2640251	hsa-miR-1281	CLIP-seq
MIRT2640252	hsa-miR-1297	CLIP-seq
MIRT2640253	hsa-miR-188-3p	CLIP-seq
MIRT2640254	hsa-miR-26a	CLIP-seq
MIRT2640255	hsa-miR-26b	CLIP-seq
MIRT1416413	hsa-miR-3149	CLIP-seq
MIRT2640256	hsa-miR-3156-3p	CLIP-seq
MIRT2640257	hsa-miR-3614-5p	CLIP-seq
MIRT2640258	hsa-miR-3920	CLIP-seq
MIRT1416417	hsa-miR-3935	CLIP-seq
MIRT1416418	hsa-miR-411	CLIP-seq
MIRT2640259	hsa-miR-432	CLIP-seq
MIRT2640260	hsa-miR-4465	CLIP-seq
MIRT1416422	hsa-miR-4532	CLIP-seq
MIRT2640261	hsa-miR-4666-5p	CLIP-seq
MIRT1416430	hsa-miR-4735-5p	CLIP-seq
MIRT2640262	hsa-miR-4740-3p	CLIP-seq
MIRT1416433	hsa-miR-4775	CLIP-seq
MIRT1416434	hsa-miR-4783-5p	CLIP-seq
MIRT1416437	hsa-miR-590-3p	CLIP-seq
MIRT2640263	hsa-miR-642b	CLIP-seq
MIRT2640264	hsa-miR-718	CLIP-seq
MIRT2640265	hsa-miR-890	CLIP-seq
MIRT2640251	hsa-miR-1281	CLIP-seq
MIRT2640252	hsa-miR-1297	CLIP-seq
MIRT2640254	hsa-miR-26a	CLIP-seq
MIRT2640255	hsa-miR-26b	CLIP-seq
MIRT1416413	hsa-miR-3149	CLIP-seq
MIRT2640260	hsa-miR-4465	CLIP-seq
MIRT1416422	hsa-miR-4532	CLIP-seq
MIRT1416430	hsa-miR-4735-5p	CLIP-seq
MIRT1416433	hsa-miR-4775	CLIP-seq
MIRT1416434	hsa-miR-4783-5p	CLIP-seq
MIRT1416437	hsa-miR-590-3p	CLIP-seq
MIRT2640264	hsa-miR-718	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
CTNNB1	Unknown	17724465

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	18579517, 20128911
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001217	Function	DNA-binding transcription repressor activity	ISS
GO:0005515	Function	Protein binding	IPI	9783587, 16442529, 17218525, 17510365, 19358846, 20028982, 25678599, 26079538
GO:0005634	Component	Nucleus	IDA	18579517
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006955	Process	Immune response	TAS	1569101
GO:0008013	Function	Beta-catenin binding	IDA	9488439
GO:0016604	Component	Nuclear body	IDA
GO:0033153	Process	T cell receptor V(D)J recombination	IEA
GO:0042492	Process	Gamma-delta T cell differentiation	ISS
GO:0045586	Process	Regulation of gamma-delta T cell differentiation	ISS
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0071353	Process	Cellular response to interleukin-4	IDA	18579517
GO:1904837	Process	Beta-catenin-TCF complex assembly	TAS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990907	Component	Beta-catenin-TCF complex	IBA	21873635

MIM	HGNC	e!Ensembl
189908	11639	ENSG00000081059

Protein

UniProt ID

P36402

Protein name

Transcription factor 7 (TCF-7) (T-cell-specific transcription factor 1) (T-cell factor 1) (TCF-1)

Protein function

Transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4(+) CD8(+) immature thymocytes. Isoforms lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. Binds to the T-lymphocyte-s

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08347	CTNNB1_binding	1 → 212	N-terminal CTNNB1 binding	Family
PF00505	HMG_box	269 → 337	HMG (high mobility group) box	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in T-cells. Also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. {ECO:0000269|PubMed:10489374}.

Sequence

MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKET
VYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQ
KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPS
GKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAIN
QILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTET
NWPRELKDGNGQESLSMSSSSSPA

Sequence length

384

Interactions

View interactions

Show/Hide Unknown Diseases (7)

Disease term	Disease name	Source
Unknown
Alopecia Areata	Alopecia Areata	GWAS
Eczema	Eczema	GWAS
Hypothyroidism	Hypothyroidism	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Multiple Sclerosis	Multiple Sclerosis	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	GWAS
Asthma	Asthma	GWAS

Show/Hide Text Mining Associations (53)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Coronary Syndrome	Associate	34151742
Adenocarcinoma of Lung	Associate	37536668
Adenoma	Associate	19749792
Anophthalmia with pulmonary hypoplasia	Associate	26578390
Arthritis Psoriatic	Associate	16622521
Astrocytoma	Stimulate	30468298
Carcinoma Renal Cell	Associate	23572277
Carcinoma Small Cell	Associate	34657342
CD59 Deficiency	Associate	18045485
Colorectal Neoplasms	Associate	19749792, 22778133, 30999858, 32407773
Cytokine Release Syndrome	Associate	40168725
Diabetes Mellitus Type 1	Associate	18045485, 19956102, 19956109
Diabetic Nephropathies	Associate	31298342
Diabetic Nephropathies	Stimulate	36583231
Down Syndrome	Associate	21124956
Glioblastoma	Associate	38268923
Hepatoblastoma	Associate	33651649
Hypoxia	Associate	25329529
Idiopathic Pulmonary Fibrosis	Associate	18478089
Infections	Associate	25329529, 32760119, 36271148
Klatskin Tumor	Stimulate	31248836
Leukemia	Associate	32692727, 35020836
Leukemia Lymphocytic Chronic B Cell	Associate	19951976, 24883311, 26606983, 36211334
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	33416164
Lupus Erythematosus Systemic	Associate	26808113, 28062664, 28128292
Lymphatic Diseases	Associate	31133633
Lymphoma	Associate	12707037
Lymphoma B Cell	Associate	35767735
Lymphoma Large Cell Anaplastic	Associate	20511667, 22899583
Lymphoma Non Hodgkin	Associate	32788236
Lymphoma T Cell Peripheral	Associate	12707037
Melanoma	Associate	33275172, 34764492
Monoclonal Gammopathy of Undetermined Significance	Associate	31013254
Mucocutaneous Lymph Node Syndrome	Associate	15889128
Multiple Myeloma	Stimulate	32578294
Multiple Sclerosis	Inhibit	26714756
Neoplasm Metastasis	Associate	31133633
Neoplasms	Associate	19435525, 23572277, 24551047, 26578390, 30999858, 33416164, 34657342, 35176128, 35460379, 35588138, 36211334, 37536668
Neoplasms	Inhibit	19749792
Neoplasms Second Primary	Stimulate	25807342
Neuroendocrine Tumors	Associate	37534217
Osteoarthritis	Inhibit	29806631
Osteosarcoma	Associate	27683056
Ovarian Neoplasms	Associate	39985498
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	12707037
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	27151989
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12707037, 32142900, 35020836
Pulmonary Disease Chronic Obstructive	Associate	23590301, 25407108
Respiratory Tract Diseases	Associate	25329529
Stevens Johnson Syndrome	Inhibit	31929762
Stomach Neoplasms	Associate	31133633
Tuberculosis Pulmonary	Inhibit	28333932
Wounds and Injuries	Associate	36583231, 36988257

TCF7 (transcription factor 7)