Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6794
Gene name Gene Name - the full gene name approved by the HGNC.
Serine/threonine kinase 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STK11
Synonyms (NCBI Gene) Gene synonyms aliases
LKB1, PJS, hLKB1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs2075607 G>A,C,T Likely-benign, conflicting-interpretations-of-pathogenicity, benign Intron variant
rs9282859 C>G,T Likely-benign, benign, pathogenic Synonymous variant, stop gained, coding sequence variant
rs112675807 G>A,C,T Pathogenic Splice acceptor variant
rs121913315 G>A,T Pathogenic-likely-pathogenic, pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs121913316 A>T Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020252 hsa-miR-130b-3p Sequencing 20371350
MIRT028122 hsa-miR-93-5p Sequencing 20371350
MIRT050817 hsa-miR-17-5p CLASH 23622248
MIRT052942 hsa-miR-199a-3p Luciferase reporter assay, Western blot 22265968
MIRT052942 hsa-miR-199a-3p Luciferase reporter assay, Western blot 22265968
Transcription factors
Transcription factor Regulation Reference
NFYA Unknown 22412893
NFYB Unknown 22412893
NKX2-1 Repression 23995788
NR1H4 Activation 22265968
SP1 Unknown 22412893;23995788
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000287 Function Magnesium ion binding IDA 12805220
GO:0001558 Process Regulation of cell growth IEA
GO:0001558 Process Regulation of cell growth ISS
GO:0001894 Process Tissue homeostasis IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602216 11389 ENSG00000118046
Protein
UniProt ID Q15831
Protein name Serine/threonine-protein kinase STK11 (EC 2.7.11.1) (Liver kinase B1) (LKB1) (hLKB1) (Renal carcinoma antigen NY-REN-19)
Protein function Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage respo
PDB 2WTK , 4ZDR , 5WXN , 8VSU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 49 309 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Strongest expression in testis and fetal liver.
Sequence
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWF
RKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ
Sequence length 433
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Melanoma Melanoma, cutaneous malignant, susceptibility to, 1, melanoma rs121913323, rs1057520039, rs137853080, rs121913321, rs137853081, rs121913315 N/A
neoplasm Neoplasm rs587782018, rs786201090, rs1131690921, rs121913321 N/A
Ovarian cancer Familial ovarian cancer rs112675807, rs121913321 N/A
Peutz-Jeghers Syndrome peutz-jeghers syndrome rs1131690940, rs876661012, rs397518442, rs1599924500, rs1555738863, rs121913317, rs587776657, rs878853992, rs778376925, rs1599928360, rs1131690949, rs876658584, rs587782424, rs1555738219, rs1057520041
View all (99 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Adenomatous Polyposis Familial adenomatous polyposis 2 N/A N/A ClinVar
Arthrogryposis, With Impaired Proprioception And Touch arthrogryposis, distal, with impaired proprioception and touch N/A N/A ClinVar
Bile Duct Neoplasms Bile duct cancer N/A N/A ClinVar
Breast Cancer Malignant tumor of breast N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Injuries Associate 20497868
ACTH Secreting Pituitary Adenoma Associate 27615706
Adenocarcinoma Associate 10079245, 11389158, 14511408, 23287851, 26317919, 29219616, 29370903, 30885352, 30978501, 31407221, 31988001
Adenocarcinoma Mucinous Associate 12533684, 31243107, 34103667, 38369337
Adenocarcinoma of Lung Associate 10079245, 17711506, 19347029, 20559149, 21159649, 21532627, 22460425, 22590557, 24236184, 24419424, 25465874, 25695224, 26066407, 26069186, 26829311
View all (26 more)
Adenoma Associate 19955943, 31248021
Adenoma Liver Cell Associate 35961004
Adenomatous Polyposis Coli Associate 21940722
Angioedemas Hereditary Associate 37495171
Anodontia Associate 28911955