Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6777
Gene name	Signal transducer and activator of transcription 5B
Gene symbol	STAT5B
Synonyms (NCBI Gene)	GHISID2STAT5
Chromosome	17
Chromosome location	17q21.2
Summary	The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran

Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121908501	C>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs121908502	G>A	Pathogenic	Coding sequence variant, stop gained
rs143171571	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs143172354	C>G,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, genic downstream transcript variant
rs148793995	C>G	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs761761205	G>-,GG	Pathogenic	Coding sequence variant, frameshift variant
rs1555548678	G>A	Pathogenic	Coding sequence variant, missense variant
rs1555548680	T>C	Pathogenic	Coding sequence variant, missense variant
rs1555549674	T>G	Pathogenic	Coding sequence variant, missense variant

273

Show/Hide all (273)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023476	hsa-miR-23b-3p	Sequencing	20371350
MIRT042849	hsa-miR-324-3p	CLASH	23622248
MIRT038811	hsa-miR-93-3p	CLASH	23622248
MIRT036362	hsa-miR-1229-3p	CLASH	23622248
MIRT054842	hsa-miR-134-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	24440911
MIRT635719	hsa-miR-8485	HITS-CLIP	23313552
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT287194	hsa-miR-19a-3p	HITS-CLIP	23313552
MIRT287195	hsa-miR-19b-3p	HITS-CLIP	23313552
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT648654	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT497821	hsa-miR-4762-5p	PAR-CLIP	22291592
MIRT497820	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT497819	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT497818	hsa-miR-1914-3p	PAR-CLIP	22291592
MIRT497817	hsa-miR-5194	PAR-CLIP	22291592
MIRT497816	hsa-miR-6738-5p	PAR-CLIP	22291592
MIRT497815	hsa-miR-526b-5p	PAR-CLIP	22291592
MIRT497814	hsa-miR-6834-5p	PAR-CLIP	22291592
MIRT497813	hsa-miR-1226-5p	PAR-CLIP	22291592
MIRT497812	hsa-miR-6734-5p	PAR-CLIP	22291592
MIRT497811	hsa-miR-335-3p	PAR-CLIP	22291592
MIRT732355	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blot	27447965
MIRT732355	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blot	27447965
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT575421	hsa-miR-8485	HITS-CLIP	27418678
MIRT575421	hsa-miR-8485	HITS-CLIP	27418678
MIRT575421	hsa-miR-8485	HITS-CLIP	27418678
MIRT735577	hsa-miR-5094	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32127949
MIRT575421	hsa-miR-8485	HITS-CLIP	23313552
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT287194	hsa-miR-19a-3p	HITS-CLIP	23313552
MIRT287195	hsa-miR-19b-3p	HITS-CLIP	23313552
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT648654	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT497821	hsa-miR-4762-5p	PAR-CLIP	22291592
MIRT497820	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT497819	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT497818	hsa-miR-1914-3p	PAR-CLIP	22291592
MIRT497817	hsa-miR-5194	PAR-CLIP	22291592
MIRT497816	hsa-miR-6738-5p	PAR-CLIP	22291592
MIRT497815	hsa-miR-526b-5p	PAR-CLIP	22291592
MIRT497814	hsa-miR-6834-5p	PAR-CLIP	22291592
MIRT497813	hsa-miR-1226-5p	PAR-CLIP	22291592
MIRT497812	hsa-miR-6734-5p	PAR-CLIP	22291592
MIRT497811	hsa-miR-335-3p	PAR-CLIP	22291592
MIRT1396002	hsa-miR-1229	CLIP-seq
MIRT1396003	hsa-miR-1237	CLIP-seq
MIRT1396004	hsa-miR-1248	CLIP-seq
MIRT1396005	hsa-miR-1251	CLIP-seq
MIRT1396006	hsa-miR-1273e	CLIP-seq
MIRT1396007	hsa-miR-1275	CLIP-seq
MIRT1396008	hsa-miR-129-5p	CLIP-seq
MIRT1396009	hsa-miR-1324	CLIP-seq
MIRT1396010	hsa-miR-134	CLIP-seq
MIRT1396011	hsa-miR-138	CLIP-seq
MIRT1396012	hsa-miR-1827	CLIP-seq
MIRT1396013	hsa-miR-19a	CLIP-seq
MIRT1396014	hsa-miR-19b	CLIP-seq
MIRT1396015	hsa-miR-302f	CLIP-seq
MIRT1396016	hsa-miR-3074-3p	CLIP-seq
MIRT1396017	hsa-miR-3118	CLIP-seq
MIRT1396018	hsa-miR-3131	CLIP-seq
MIRT1396019	hsa-miR-3155	CLIP-seq
MIRT1396020	hsa-miR-3155b	CLIP-seq
MIRT1396021	hsa-miR-3164	CLIP-seq
MIRT1396022	hsa-miR-3166	CLIP-seq
MIRT1396023	hsa-miR-3175	CLIP-seq
MIRT1396024	hsa-miR-3591-3p	CLIP-seq
MIRT1396025	hsa-miR-3613-3p	CLIP-seq
MIRT1396026	hsa-miR-3620	CLIP-seq
MIRT1396027	hsa-miR-3622a-5p	CLIP-seq
MIRT1396028	hsa-miR-3654	CLIP-seq
MIRT1396029	hsa-miR-3665	CLIP-seq
MIRT1396030	hsa-miR-3673	CLIP-seq
MIRT1396031	hsa-miR-3685	CLIP-seq
MIRT1396032	hsa-miR-3942-3p	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT1396034	hsa-miR-4423-3p	CLIP-seq
MIRT1396035	hsa-miR-4447	CLIP-seq
MIRT1396036	hsa-miR-4472	CLIP-seq
MIRT1396037	hsa-miR-4525	CLIP-seq
MIRT1396038	hsa-miR-4638-3p	CLIP-seq
MIRT1396039	hsa-miR-4639-3p	CLIP-seq
MIRT1396040	hsa-miR-4651	CLIP-seq
MIRT1396041	hsa-miR-4665-5p	CLIP-seq
MIRT1396042	hsa-miR-4705	CLIP-seq
MIRT1396043	hsa-miR-4723-5p	CLIP-seq
MIRT1396044	hsa-miR-4731-3p	CLIP-seq
MIRT1396045	hsa-miR-4736	CLIP-seq
MIRT1396046	hsa-miR-4747-5p	CLIP-seq
MIRT1396047	hsa-miR-4753-3p	CLIP-seq
MIRT1396048	hsa-miR-4797-5p	CLIP-seq
MIRT1396049	hsa-miR-4801	CLIP-seq
MIRT1396050	hsa-miR-484	CLIP-seq
MIRT1396051	hsa-miR-501-3p	CLIP-seq
MIRT1396052	hsa-miR-502-3p	CLIP-seq
MIRT1396053	hsa-miR-608	CLIP-seq
MIRT1396054	hsa-miR-611	CLIP-seq
MIRT1396055	hsa-miR-618	CLIP-seq
MIRT1396056	hsa-miR-625	CLIP-seq
MIRT1396057	hsa-miR-645	CLIP-seq
MIRT1396058	hsa-miR-758	CLIP-seq
MIRT1396059	hsa-miR-759	CLIP-seq
MIRT1396060	hsa-miR-764	CLIP-seq
MIRT1396061	hsa-miR-940	CLIP-seq
MIRT1396062	hsa-miR-943	CLIP-seq
MIRT2118735	hsa-miR-1262	CLIP-seq
MIRT2118736	hsa-miR-1285	CLIP-seq
MIRT2118737	hsa-miR-1343	CLIP-seq
MIRT1396011	hsa-miR-138	CLIP-seq
MIRT1396012	hsa-miR-1827	CLIP-seq
MIRT2118738	hsa-miR-185	CLIP-seq
MIRT2118739	hsa-miR-1976	CLIP-seq
MIRT1396013	hsa-miR-19a	CLIP-seq
MIRT1396014	hsa-miR-19b	CLIP-seq
MIRT2118740	hsa-miR-3123	CLIP-seq
MIRT1396023	hsa-miR-3175	CLIP-seq
MIRT2118741	hsa-miR-3183	CLIP-seq
MIRT2118742	hsa-miR-3185	CLIP-seq
MIRT2118743	hsa-miR-3187-5p	CLIP-seq
MIRT2118744	hsa-miR-3192	CLIP-seq
MIRT2118745	hsa-miR-342-5p	CLIP-seq
MIRT1396025	hsa-miR-3613-3p	CLIP-seq
MIRT1396029	hsa-miR-3665	CLIP-seq
MIRT2118746	hsa-miR-3929	CLIP-seq
MIRT2118747	hsa-miR-4270	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT2118748	hsa-miR-4306	CLIP-seq
MIRT2118749	hsa-miR-4311	CLIP-seq
MIRT2118750	hsa-miR-4419b	CLIP-seq
MIRT2118751	hsa-miR-4441	CLIP-seq
MIRT2118752	hsa-miR-4459	CLIP-seq
MIRT2118753	hsa-miR-4478	CLIP-seq
MIRT2118754	hsa-miR-4481	CLIP-seq
MIRT2118755	hsa-miR-4641	CLIP-seq
MIRT2118756	hsa-miR-4644	CLIP-seq
MIRT2118757	hsa-miR-4664-5p	CLIP-seq
MIRT2118758	hsa-miR-4699-5p	CLIP-seq
MIRT2118759	hsa-miR-4701-3p	CLIP-seq
MIRT2118760	hsa-miR-4722-5p	CLIP-seq
MIRT2118761	hsa-miR-4723-3p	CLIP-seq
MIRT1396045	hsa-miR-4736	CLIP-seq
MIRT2118762	hsa-miR-4745-5p	CLIP-seq
MIRT2118763	hsa-miR-4749-3p	CLIP-seq
MIRT2118764	hsa-miR-4767	CLIP-seq
MIRT2118765	hsa-miR-4779	CLIP-seq
MIRT2118766	hsa-miR-485-5p	CLIP-seq
MIRT2118767	hsa-miR-612	CLIP-seq
MIRT2118768	hsa-miR-615-5p	CLIP-seq
MIRT2118769	hsa-miR-637	CLIP-seq
MIRT1396060	hsa-miR-764	CLIP-seq
MIRT1396061	hsa-miR-940	CLIP-seq
MIRT1396008	hsa-miR-129-5p	CLIP-seq
MIRT1396010	hsa-miR-134	CLIP-seq
MIRT2340979	hsa-miR-141	CLIP-seq
MIRT1396013	hsa-miR-19a	CLIP-seq
MIRT1396014	hsa-miR-19b	CLIP-seq
MIRT2340980	hsa-miR-200a	CLIP-seq
MIRT2340981	hsa-miR-23a	CLIP-seq
MIRT2340982	hsa-miR-23b	CLIP-seq
MIRT2340983	hsa-miR-23c	CLIP-seq
MIRT2340984	hsa-miR-27a	CLIP-seq
MIRT2340985	hsa-miR-27b	CLIP-seq
MIRT2340986	hsa-miR-3117-5p	CLIP-seq
MIRT1396017	hsa-miR-3118	CLIP-seq
MIRT2340987	hsa-miR-3129-3p	CLIP-seq
MIRT1396021	hsa-miR-3164	CLIP-seq
MIRT2340988	hsa-miR-3176	CLIP-seq
MIRT2340989	hsa-miR-320e	CLIP-seq
MIRT2340990	hsa-miR-3922-3p	CLIP-seq
MIRT2340991	hsa-miR-3923	CLIP-seq
MIRT2340992	hsa-miR-3974	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT2340993	hsa-miR-4312	CLIP-seq
MIRT2340994	hsa-miR-4470	CLIP-seq
MIRT2340995	hsa-miR-4699-3p	CLIP-seq
MIRT2118758	hsa-miR-4699-5p	CLIP-seq
MIRT2340996	hsa-miR-4722-3p	CLIP-seq
MIRT2340997	hsa-miR-4755-3p	CLIP-seq
MIRT2340998	hsa-miR-496	CLIP-seq
MIRT2340999	hsa-miR-513a-5p	CLIP-seq
MIRT2341000	hsa-miR-514	CLIP-seq
MIRT2341001	hsa-miR-514b-3p	CLIP-seq
MIRT1396058	hsa-miR-758	CLIP-seq
MIRT2395297	hsa-miR-1271	CLIP-seq
MIRT1396013	hsa-miR-19a	CLIP-seq
MIRT1396014	hsa-miR-19b	CLIP-seq
MIRT2395298	hsa-miR-4264	CLIP-seq
MIRT2395299	hsa-miR-4797-3p	CLIP-seq
MIRT2395300	hsa-miR-935	CLIP-seq
MIRT2395301	hsa-miR-96	CLIP-seq
MIRT1396003	hsa-miR-1237	CLIP-seq
MIRT1396004	hsa-miR-1248	CLIP-seq
MIRT2634870	hsa-miR-1287	CLIP-seq
MIRT1396011	hsa-miR-138	CLIP-seq
MIRT1396012	hsa-miR-1827	CLIP-seq
MIRT2634871	hsa-miR-204	CLIP-seq
MIRT2634872	hsa-miR-211	CLIP-seq
MIRT2634873	hsa-miR-218	CLIP-seq
MIRT2634874	hsa-miR-2355-3p	CLIP-seq
MIRT2634875	hsa-miR-296-3p	CLIP-seq
MIRT2634876	hsa-miR-3135b	CLIP-seq
MIRT2634877	hsa-miR-3160-5p	CLIP-seq
MIRT1396029	hsa-miR-3665	CLIP-seq
MIRT2634878	hsa-miR-3680	CLIP-seq
MIRT2634879	hsa-miR-4257	CLIP-seq
MIRT2634880	hsa-miR-4272	CLIP-seq
MIRT2634881	hsa-miR-4279	CLIP-seq
MIRT2634882	hsa-miR-4287	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT2634883	hsa-miR-4330	CLIP-seq
MIRT2634884	hsa-miR-4432	CLIP-seq
MIRT2634885	hsa-miR-4646-3p	CLIP-seq
MIRT2634886	hsa-miR-4685-3p	CLIP-seq
MIRT2634887	hsa-miR-4691-3p	CLIP-seq
MIRT1396045	hsa-miR-4736	CLIP-seq
MIRT1396047	hsa-miR-4753-3p	CLIP-seq
MIRT2634888	hsa-miR-636	CLIP-seq
MIRT2634889	hsa-miR-676	CLIP-seq
MIRT1396060	hsa-miR-764	CLIP-seq
MIRT1396061	hsa-miR-940	CLIP-seq
MIRT2634890	hsa-miR-942	CLIP-seq
MIRT2634870	hsa-miR-1287	CLIP-seq
MIRT1396011	hsa-miR-138	CLIP-seq
MIRT1396012	hsa-miR-1827	CLIP-seq
MIRT2634873	hsa-miR-218	CLIP-seq
MIRT2634875	hsa-miR-296-3p	CLIP-seq
MIRT2634876	hsa-miR-3135b	CLIP-seq
MIRT2634877	hsa-miR-3160-5p	CLIP-seq
MIRT1396029	hsa-miR-3665	CLIP-seq
MIRT2634878	hsa-miR-3680	CLIP-seq
MIRT2634879	hsa-miR-4257	CLIP-seq
MIRT2634881	hsa-miR-4279	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT2634883	hsa-miR-4330	CLIP-seq
MIRT2634884	hsa-miR-4432	CLIP-seq
MIRT1396045	hsa-miR-4736	CLIP-seq
MIRT2634888	hsa-miR-636	CLIP-seq
MIRT1396060	hsa-miR-764	CLIP-seq
MIRT1396061	hsa-miR-940	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ZNF382	Repression	20682794

107

Show/Hide all (107)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	29844444
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001553	Process	Luteinization	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001787	Process	Natural killer cell proliferation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8631883
GO:0005515	Function	Protein binding	IPI	9989503, 21106534, 31175292, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	29844444
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	29844444
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8631883
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006952	Process	Defense response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	24058793
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	8631883
GO:0007548	Process	Sex differentiation	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007595	Process	Lactation	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0019218	Process	Regulation of steroid metabolic process	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019530	Process	Taurine metabolic process	IEA
GO:0019530	Process	Taurine metabolic process	ISS
GO:0019915	Process	Lipid storage	IEA
GO:0030098	Process	Lymphocyte differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030856	Process	Regulation of epithelial cell differentiation	IEA
GO:0032355	Process	Response to estradiol	IDA	12552091
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IDA	12552091
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IPI	12552091
GO:0038162	Process	Erythropoietin-mediated signaling pathway	IDA	9657743
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0040014	Process	Regulation of multicellular organism growth	ISS
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042448	Process	Progesterone metabolic process	IEA
GO:0042492	Process	Gamma-delta T cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IPI	31175292
GO:0042803	Function	Protein homodimerization activity	IDA	29844444
GO:0043029	Process	T cell homeostasis	IEA
GO:0043434	Process	Response to peptide hormone	IBA
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045588	Process	Positive regulation of gamma-delta T cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IDA	20702587
GO:0045931	Process	Positive regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	24058793
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IEA
GO:0046543	Process	Development of secondary female sexual characteristics	IEA
GO:0046544	Process	Development of secondary male sexual characteristics	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0046983	Function	Protein dimerization activity	ISS
GO:0048541	Process	Peyer's patch development	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	12552091
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IEA
GO:0070669	Process	Response to interleukin-2	IEA
GO:0070670	Process	Response to interleukin-4	IEA
GO:0070672	Process	Response to interleukin-15	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	ISS
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	24058793
GO:0097531	Process	Mast cell migration	IEA
GO:1903706	Process	Regulation of hemopoiesis	IEA

MIM	HGNC	e!Ensembl
604260	11367	ENSG00000173757

P51692

Protein name

Signal transducer and activator of transcription 5B

Protein function

Carries out a dual function: signal transduction and activation of transcription (PubMed:29844444). Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.

PDB

6MBW , 6MBZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02865	STAT_int	2 → 124	STAT protein, protein interaction domain	Domain
PF01017	STAT_alpha	141 → 324	STAT protein, all-alpha domain	Family
PF02864	STAT_bind	336 → 469	STAT protein, DNA binding domain	Domain
PF00017	SH2	589 → 670	SH2 domain	Domain

Sequence

MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS

Sequence length

787

Interactions

View interactions

454

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Familial prostate cancer	Likely pathogenic	rs750399917	RCV005912596
Growth hormone insensitivity syndrome with immune dysregulation 2, autosomal dominant	Likely pathogenic; Pathogenic	rs2508724440, rs1555548680, rs1555549674	RCV003158006 RCV001254780 RCV001254778
Growth hormone insensitivity with immune dysregulation 1, autosomal recessive	Likely pathogenic; Pathogenic	rs750399917, rs767959957, rs778995803, rs2144267361, rs2080191165, rs2144219508, rs2508776887, rs2508803926, rs121908501, rs2508751004, rs121908502, rs2508731535, rs1202978138, rs2508803545, rs1000458475 View all (6 more)	RCV001377593 RCV001387244 RCV001898567 RCV001937990 RCV001960505 RCV002246745 RCV002811147 RCV002830220 RCV000006048 RCV000006049 RCV000006051 RCV000006052 RCV003054595 RCV003506657 RCV003614555 RCV003614753 RCV003614997 RCV003818554 RCV000625734 RCV000625745 RCV000703112 RCV001042704

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Gastric cancer	Benign	rs201981865	RCV005914319
Growth hormone insensitivity syndrome with immune dysregulation	Uncertain significance	rs1031852875	RCV003458609
Neoplasm	Conflicting classifications of pathogenicity	rs938448224	RCV005231378
Short stature	Uncertain significance	rs138255473	RCV005235505
STAT5B-related disorder	Uncertain significance; Likely benign; Benign	rs777110652, rs760154055, rs202154803, rs2508749885, rs919883933, rs2144237225, rs750053820, rs147503881	RCV003393997 RCV004756454 RCV003939104 RCV003894577 RCV003947161 RCV003983509 RCV003432777 RCV003923320
STAT5B-related growth hormone insensitivity syndrome	Uncertain significance	rs2080197805	RCV001095742

Show/Hide Text Mining Associations (84)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Agammaglobulinemia	Associate	34670919
Anemia Aplastic	Associate	25800665
Anovulation	Associate	40287692
Autoimmune Diseases	Associate	33090292, 34670919
Breast Neoplasms	Associate	11751923, 12759236, 17822672, 17997837, 18550772, 19630967, 21205088, 25104439, 25973100, 26735495, 28422733, 29326301, 9813040
Breast Neoplasms	Inhibit	36862902
Carcinogenesis	Associate	17997837
Carcinoma Basal Cell	Associate	23774526
Carcinoma Hepatocellular	Associate	31485610
Carcinoma Non Small Cell Lung	Stimulate	25137041
Carcinoma Ovarian Epithelial	Associate	27533245
Carcinoma Pancreatic Ductal	Associate	27035235
Carcinoma Renal Cell	Associate	32640276
CD59 Deficiency	Associate	31732533
Cerebral Hemorrhage	Associate	40629603
Colorectal Neoplasms	Associate	22121102
Cyclic neutropenia	Associate	25800665
Dementia Multi Infarct	Associate	39341815
Dermatomyositis	Associate	27803134
Diabetes Mellitus	Associate	11781356, 29417186
Diabetic Angiopathies	Associate	11781356
Disease	Associate	27803134
Dwarfism Pituitary	Associate	34589056
Eczema	Associate	29844444, 33090292
Endometrial Neoplasms	Associate	35244291
Eosinophilia	Associate	30573779, 37981812, 38563187
Esophageal Squamous Cell Carcinoma	Inhibit	34616847
Extranodal Extension	Associate	29615001
Genetic Diseases Inborn	Associate	32349161
Glioblastoma	Associate	23250732, 33104022, 36069226
Glioma	Associate	35148403
Glomerulonephritis	Associate	40629603
Hodgkin Disease	Associate	29650799
Hypereosinophilic Syndrome	Associate	30573779, 38563187
Ige Responsiveness Atopic	Associate	33090292
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	25349174
Immune System Diseases	Associate	26034074, 33090292
Immunologic Deficiency Syndromes	Associate	33090292
Infections	Associate	33090292, 33832973
Inflammation	Inhibit	31732533
Inflammatory Bowel Diseases	Associate	31732533
Laron Syndrome	Associate	26034074, 29844444
Leukemia	Associate	29740158, 34967577
Leukemia	Inhibit	34210682
Leukemia B Cell	Associate	33090292
Leukemia Large Granular Lymphocytic	Associate	23596048, 29217783, 33280072, 35015834, 35210405, 40629603
Leukemia Lymphocytic Chronic B Cell	Associate	27367207, 36567979
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20065083, 37981812
Leukemia Myeloid Acute	Associate	32349161
Leukemia Plasma Cell	Associate	35666668
Leukemia Prolymphocytic T Cell	Associate	24825865, 31974418
Leukemia Promyelocytic Acute	Associate	11929748
Lung Diseases	Associate	29844444, 33090292
Lymphoma	Associate	25586472, 37329186
Lymphoma Extranodal NK T Cell	Associate	31822801
Lymphoma Mantle Cell	Associate	30964854
Lymphoma T Cell	Associate	25586472, 26854024, 28122867, 34895266, 35708139
Lymphoma T Cell Cutaneous	Associate	24523507
Lymphoma T Cell Peripheral	Associate	26536348, 29615001, 35895386
Melanoma	Associate	16741510, 32316408
Moyamoya Disease	Associate	32617116
Muscle Neoplasms	Associate	27803134
Myotonic Dystrophy	Stimulate	34462518
Neoplasm Metastasis	Inhibit	36862902
Neoplasms	Associate	17822672, 20585448, 22919439, 23774526, 25137041, 25987838, 30573779, 30964854, 37981812, 38125721
Neoplasms	Inhibit	23289016, 33256375
Neoplasms Squamous Cell	Associate	26379152
Neural Tube Defects	Associate	38563187
Oculocutaneous albinism type 2	Associate	23250732
Ovarian Neoplasms	Associate	28536310
Pancreatic Neoplasms	Associate	27035235
Pathological Conditions Anatomical	Associate	26034074
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	30573779
Polycystic Ovary Syndrome	Associate	40287692
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24367274
Primary Immunodeficiency Diseases	Associate	23773921, 34670919
Progressive hearing loss stapes fixation	Associate	12197892
Prostatic Neoplasms	Stimulate	23668334
Prostatitis	Associate	23289016
Renal Insufficiency	Associate	29844444
Severe Combined Immunodeficiency	Associate	12197892
Short Stature Idiopathic Autosomal	Associate	28768959
Space Motion Sickness	Associate	33090292
Waldenstrom Macroglobulinemia	Associate	24335105

STAT5B (signal transducer and activator of transcription 5B)