Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6776
Gene name	Signal transducer and activator of transcription 5A
Gene symbol	STAT5A
Synonyms (NCBI Gene)	MGFSTAT5
Chromosome	17
Chromosome location	17q21.2
Summary	The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran

367

Show/Hide all (367)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000018	hsa-miR-222-3p	qRT-PCRLuciferase reporter assayWestern blot	20489169
MIRT023082	hsa-miR-124-3p	Microarray	18668037
MIRT438254	hsa-miR-221-3p	Luciferase reporter assay	24736554
MIRT000018	hsa-miR-222-3p	Luciferase reporter assay	24736554
MIRT000018	hsa-miR-222-3p	Luciferase reporter assay	24736554
MIRT438254	hsa-miR-221-3p	Luciferase reporter assay	24736554
MIRT437995	hsa-miR-223-3p	Luciferase reporter assayqRT-PCR	24400121
MIRT437995	hsa-miR-223-3p	Luciferase reporter assayqRT-PCR	24400121
MIRT438254	hsa-miR-221-3p	Luciferase reporter assay	24736554
MIRT000018	hsa-miR-222-3p	Luciferase reporter assay	24736554
MIRT000018	hsa-miR-222-3p	Luciferase reporter assay	24736554
MIRT438254	hsa-miR-221-3p	Luciferase reporter assay	24736554
MIRT437995	hsa-miR-223-3p	Luciferase reporter assayqRT-PCR	24400121
MIRT437995	hsa-miR-223-3p	Luciferase reporter assayqRT-PCR	24400121
MIRT610929	hsa-miR-8080	HITS-CLIP	23313552
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23313552
MIRT610927	hsa-miR-4801	HITS-CLIP	23313552
MIRT610926	hsa-miR-8485	HITS-CLIP	23313552
MIRT610925	hsa-miR-1197	HITS-CLIP	23313552
MIRT693837	hsa-miR-4457	HITS-CLIP	23313552
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT610926	hsa-miR-8485	HITS-CLIP	23313552
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT614734	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT614733	hsa-miR-527	HITS-CLIP	23824327
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT622038	hsa-miR-603	HITS-CLIP	23824327
MIRT622037	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT622036	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622035	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622034	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT622033	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT622032	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT622031	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT622030	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT622029	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT622028	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622027	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT622026	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT622025	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT622024	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622023	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622022	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT614734	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT614733	hsa-miR-527	HITS-CLIP	23824327
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT731071	hsa-miR-141-3p	5.0	25241899
MIRT731071	hsa-miR-141-3p	5.0	25241899
MIRT731071	hsa-miR-141-3p	5.0	25241899
MIRT731071	hsa-miR-141-3p	5.0	25241899
MIRT610925	hsa-miR-1197	HITS-CLIP	27418678
MIRT693837	hsa-miR-4457	HITS-CLIP	27418678
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	27418678
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	27418678
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	27418678
MIRT610927	hsa-miR-4801	HITS-CLIP	27418678
MIRT610927	hsa-miR-4801	HITS-CLIP	27418678
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	27418678
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	27418678
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	27418678
MIRT610929	hsa-miR-8080	HITS-CLIP	27418678
MIRT610926	hsa-miR-8485	HITS-CLIP	27418678
MIRT610926	hsa-miR-8485	HITS-CLIP	27418678
MIRT734445	hsa-let-7b-5p	ELISALuciferase reporter assayqRT-PCR	33005103
MIRT736280	hsa-miR-143-3p	Microarray	32093694
MIRT610929	hsa-miR-8080	HITS-CLIP	23313552
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23313552
MIRT610927	hsa-miR-4801	HITS-CLIP	23313552
MIRT610926	hsa-miR-8485	HITS-CLIP	23313552
MIRT610925	hsa-miR-1197	HITS-CLIP	23313552
MIRT693837	hsa-miR-4457	HITS-CLIP	23313552
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT610926	hsa-miR-8485	HITS-CLIP	23313552
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT614734	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT614733	hsa-miR-527	HITS-CLIP	23824327
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT622038	hsa-miR-603	HITS-CLIP	23824327
MIRT622037	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT622036	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622035	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622034	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT622033	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT622032	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT622031	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT622030	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT622029	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT622028	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622027	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT622026	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT622025	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT622024	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622023	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622022	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT614734	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT614733	hsa-miR-527	HITS-CLIP	23824327
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT1395997	hsa-miR-1914	CLIP-seq
MIRT1395998	hsa-miR-371-5p	CLIP-seq
MIRT1395999	hsa-miR-4521	CLIP-seq
MIRT1396000	hsa-miR-4639-5p	CLIP-seq
MIRT1396001	hsa-miR-888	CLIP-seq
MIRT2118723	hsa-miR-147	CLIP-seq
MIRT2118724	hsa-miR-3622a-5p	CLIP-seq
MIRT2118725	hsa-miR-3692	CLIP-seq
MIRT2118726	hsa-miR-3911	CLIP-seq
MIRT2118727	hsa-miR-3941	CLIP-seq
MIRT2118728	hsa-miR-4269	CLIP-seq
MIRT2118729	hsa-miR-466	CLIP-seq
MIRT2118730	hsa-miR-4672	CLIP-seq
MIRT2118731	hsa-miR-4717-3p	CLIP-seq
MIRT2118732	hsa-miR-4719	CLIP-seq
MIRT2118733	hsa-miR-593	CLIP-seq
MIRT2118734	hsa-miR-644	CLIP-seq
MIRT2340975	hsa-miR-3127-3p	CLIP-seq
MIRT2340976	hsa-miR-3922-5p	CLIP-seq
MIRT2340977	hsa-miR-4717-5p	CLIP-seq
MIRT2340978	hsa-miR-4753-5p	CLIP-seq
MIRT2634863	hsa-miR-1307	CLIP-seq
MIRT2634864	hsa-miR-1469	CLIP-seq
MIRT2634865	hsa-miR-432	CLIP-seq
MIRT2634866	hsa-miR-4659a-5p	CLIP-seq
MIRT2634867	hsa-miR-4659b-5p	CLIP-seq
MIRT2340977	hsa-miR-4717-5p	CLIP-seq
MIRT2634868	hsa-miR-4766-5p	CLIP-seq
MIRT2634869	hsa-miR-583	CLIP-seq
MIRT2118733	hsa-miR-593	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PPARA	Unknown	21542777

115

Show/Hide all (115)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001553	Process	Luteinization	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	20489169
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	7568001, 8580378, 8631883, 9516478, 10919676, 12393707, 20974963
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7719937, 8631883
GO:0005515	Function	Protein binding	IPI	12237455, 16819511, 20075866, 24658140, 25416956, 31980649
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	7568001, 8631883, 12393707, 20974963
GO:0005634	Component	Nucleus	IDA	9516478
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8631883
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006952	Process	Defense response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	24058793
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	7719937
GO:0007565	Process	Female pregnancy	IEA
GO:0007595	Process	Lactation	IEA
GO:0007595	Process	Lactation	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0019218	Process	Regulation of steroid metabolic process	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019530	Process	Taurine metabolic process	IEA
GO:0019530	Process	Taurine metabolic process	ISS
GO:0019915	Process	Lipid storage	IEA
GO:0030098	Process	Lymphocyte differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030222	Process	Eosinophil differentiation	IDA	12393707
GO:0030856	Process	Regulation of epithelial cell differentiation	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IEA
GO:0033024	Process	Mast cell apoptotic process	IEA
GO:0033026	Process	Negative regulation of mast cell apoptotic process	IEA
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	7568001
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IDA	17200144
GO:0038026	Process	Reelin-mediated signaling pathway	IDA	29581031
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IDA	12393707
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	8631883
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IDA	20974963
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	10919676
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IDA	22102340
GO:0038163	Process	Thrombopoietin-mediated signaling pathway	IDA	9122198
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0040014	Process	Regulation of multicellular organism growth	ISS
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042301	Function	Phosphate ion binding	IEA
GO:0042492	Process	Gamma-delta T cell differentiation	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043434	Process	Response to peptide hormone	IBA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	20489169
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045588	Process	Positive regulation of gamma-delta T cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	24058793
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IEA
GO:0046543	Process	Development of secondary female sexual characteristics	IEA
GO:0046544	Process	Development of secondary male sexual characteristics	IEA
GO:0048541	Process	Peyer's patch development	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0060374	Process	Mast cell differentiation	IEA
GO:0060376	Process	Positive regulation of mast cell differentiation	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0060742	Process	Epithelial cell differentiation involved in prostate gland development	IEA
GO:0061180	Process	Mammary gland epithelium development	IEA
GO:0070662	Process	Mast cell proliferation	IEA
GO:0070668	Process	Positive regulation of mast cell proliferation	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	24058793
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	35939714
GO:1903706	Process	Regulation of hemopoiesis	IEA
GO:2000329	Process	Negative regulation of T-helper 17 cell lineage commitment	IDA	20696842

MIM	HGNC	e!Ensembl
601511	11366	ENSG00000126561

P42229

Protein name

Signal transducer and activator of transcription 5A

Protein function

Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated F

PDB

7TVA , 7TVB , 7UBT , 7UC6 , 7UC7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02865	STAT_int	2 → 124	STAT protein, protein interaction domain	Domain
PF01017	STAT_alpha	141 → 324	STAT protein, all-alpha domain	Family
PF02864	STAT_bind	336 → 469	STAT protein, DNA binding domain	Domain
PF00017	SH2	589 → 670	SH2 domain	Domain

Sequence

MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATY
MDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS

Sequence length

794

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Esophageal atresia	Uncertain significance	rs1598364148	RCV000984687
Pyloric stenosis	Uncertain significance	rs1598364148	RCV000984687

Show/Hide Text Mining Associations (182)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achondroplasia	Associate	19802676
Adenocarcinoma of Lung	Associate	32686362
Alzheimer Disease	Associate	32854783, 33239300
Anemia Aplastic	Associate	33586472
Anemia Refractory with Excess of Blasts	Stimulate	11027834
Aortic Aneurysm Abdominal	Associate	21493888, 21764069, 25993293
Aortic Aneurysm Familial Abdominal 1	Associate	21493888
Arthritis Rheumatoid	Associate	25164131, 27629845, 31167762, 31181818, 32998457, 33362761, 35887269, 36726974
Arthritis Rheumatoid	Stimulate	35706043
Ascites	Associate	34359872
Asthma	Associate	16081849
Ataxia Telangiectasia	Associate	20334914
Autoimmune Diseases	Associate	22461703
Axial Spondyloarthritis	Associate	26671920
Barrett Esophagus	Associate	17947454
Bone Diseases Metabolic	Associate	26390436
Breast Neoplasms	Associate	12888825, 15686596, 16253990, 18254957, 18271926, 18378698, 19014541, 19036881, 19262752, 19491198, 20854925, 20952588, 21205088, 21576635, 21964595 View all (18 more)
Breast Neoplasms	Inhibit	36862902, 38124049
Bronchiolitis	Associate	26541527
Calcinosis Cutis	Associate	20854925
Cancer Pain	Associate	14521520
Carcinogenesis	Associate	19290007, 23915238, 31646566, 33227411, 34188118
Carcinoma Ductal	Associate	24384092
Carcinoma Hepatocellular	Associate	31485610, 33155364, 35871161, 36994687
Carcinoma Hepatocellular	Inhibit	36374927
Carcinoma Intraductal Noninfiltrating	Associate	26146825
Carcinoma Non Small Cell Lung	Stimulate	25137041
Carcinoma Non Small Cell Lung	Associate	28972958, 31599032
Carcinoma Pancreatic Ductal	Associate	27035235, 39684873
Carcinoma Renal Cell	Associate	17279417, 20339477, 22363690, 26911335, 31401673
CD59 Deficiency	Associate	31732533
Cell Transformation Neoplastic	Associate	21816901
Cholangiocarcinoma	Associate	35683032
Chromosome 7 monosomy	Associate	16980411
Chronic Disease	Associate	17376889
Colonic Neoplasms	Associate	19290007, 21234733
Colonic Neoplasms	Stimulate	30013992
Colorectal Neoplasms	Associate	19290007, 20196786, 21234733, 22121102, 24097071, 29118272, 30013992, 30670049, 31718693, 35502613
Coronary Disease	Associate	27997991
Coronary Restenosis	Associate	35144391
COVID 19	Associate	32513989
Craniosynostoses	Stimulate	36312898
Crohn Disease	Associate	26278503
Cystitis Interstitial	Associate	39399486
Death	Associate	23026195
Diabetes Mellitus Type 1	Associate	24204704
Diabetes Mellitus Type 2	Inhibit	17030965
Diabetes Mellitus Type 2	Associate	31332162
Diabetic Foot	Associate	35394091
Diabetic Nephropathies	Associate	23242724
Drug Related Side Effects and Adverse Reactions	Associate	16868253
Dyserythropoietic Anemia with Thrombocytopenia	Stimulate	36952639
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	16684963
Endometrial Neoplasms	Associate	29951943, 35244291
Endometriosis	Associate	24133578
Epstein Barr Virus Infections	Stimulate	12634372
Esophageal Neoplasms	Associate	23915238, 32536038
Esophageal Squamous Cell Carcinoma	Associate	31037126
Fatigue Syndrome Chronic	Associate	18596870
Fetal Growth Retardation	Associate	35090410
Giant Cell Arteritis	Associate	35045965
Glioblastoma	Associate	23250732, 27788487, 28157712, 29724813, 33104022
Glioma	Associate	37616578
Granulomatosis with Polyangiitis	Associate	35039330
Graves Disease	Associate	33912135
Hemangioblastoma	Associate	27748427
Hematologic Neoplasms	Associate	24435449, 24910998, 26717567, 27566554, 27853239, 37830151
Hepatitis C	Associate	27315061
Hepatoblastoma	Associate	38071211
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30394935
Hereditary leiomyomatosis and renal cell cancer	Associate	12208876, 15354186
HIV Infections	Associate	10590065, 18490721, 19239367, 19864382, 35911692
HIV Infections	Inhibit	21920046
Hodgkin Disease	Associate	12208876, 18296629
HTLV I Infections	Inhibit	14610185
Hypereosinophilic Syndrome	Associate	38563187
Hypoxia	Associate	21698228
Hypoxia Brain	Associate	27055152
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	36374927
Infections	Associate	21698228
Inflammation	Associate	18037968, 24204704, 27853239, 31732533, 33590796, 33948920, 35015026, 36726974, 37106040, 37342057, 38629639
Inflammatory Bowel Diseases	Associate	26278503, 31732533
Insulin Resistance	Associate	36238467, 38018587
Iron Overload	Inhibit	31838956
Kidney Neoplasms	Associate	31401673
Leukemia	Associate	10090948, 10536003, 10812249, 11313280, 17630355, 19709433, 19956772, 21091189, 21356308, 23451206, 24435449, 24761846, 25953263, 27566554, 30185437 View all (5 more)
Leukemia Biphenotypic Acute	Associate	34157051
Leukemia Large Granular Lymphocytic	Associate	23596048
Leukemia Lymphocytic Chronic B Cell	Stimulate	11126203
Leukemia Lymphocytic Chronic B Cell	Associate	18537972, 23072591, 27367207, 30988120, 32667731
Leukemia Lymphoma Adult T Cell	Associate	10229324, 16603085, 9391124
Leukemia Megakaryoblastic Acute	Associate	9111365
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	16278304, 19047139, 19363496, 21091189, 21233313, 21356308, 22151181, 22285998, 22387217, 27566554, 28560425, 28596283, 28631564, 31582541, 31952546 View all (5 more)
Leukemia Myeloid	Associate	11313280, 27566554, 31546234, 32667731, 39746237
Leukemia Myeloid Acute	Associate	10586114, 11698483, 12351411, 12663443, 16946300, 17630355, 21048955, 25006129, 28204819, 28667329, 31434952, 32024878, 32393312, 33948920, 35839275 View all (7 more)
Leukemia Myeloid Acute	Stimulate	11027834, 15498775, 24394665
Leukemia Myelomonocytic Juvenile	Associate	18835035, 23620576, 26456833
Leukemia Prolymphocytic T Cell	Associate	24825865
Leukemia Promyelocytic Acute	Associate	11929749, 17913706
Leukemia T Cell	Associate	24223100, 25170111
Lipoma	Associate	24681953
Liver Diseases	Associate	28176332
Lung Neoplasms	Associate	22348039
Lupus Erythematosus Systemic	Associate	25187566
Lymphatic Metastasis	Associate	21234733
Lymphatic Metastasis	Inhibit	40003884
Lymphoma	Associate	19363496, 21418178, 23372669, 24435449, 8704235
Lymphoma B Cell	Associate	31601188
Lymphoma B Cell Marginal Zone	Associate	35686915
Lymphoma Follicular	Associate	23451206
Lymphoma Non Hodgkin	Associate	34841595
Lymphoma T Cell	Associate	28005077
Lymphoma T Cell Cutaneous	Associate	23676217, 24523507, 25485578, 25779945, 25915535, 26244872, 27144517, 27329723, 29751003
Mammary Analogue Secretory Carcinoma	Associate	25481229, 26252941
Mast Cell Activation Disorders	Associate	17662084
Mastocytosis Systemic	Associate	19747364, 19893034, 21457934
Melanoma	Associate	16169484, 16741510, 30358226
Mesothelioma	Associate	36901697
Mesothelioma Malignant	Associate	27987139
Mouth Neoplasms	Associate	34318593
Mucocutaneous Lymph Node Syndrome	Associate	25039241
Multiple Myeloma	Associate	14726660, 22177381
Mycosis Fungoides	Associate	25779945
Myelodysplastic Syndromes	Associate	10460607, 11861273, 31838956, 9057652
Myeloproliferative Disorders	Associate	17440089, 21233313
Myostatin related muscle hypertrophy	Associate	18240972
Nasal Polyps	Associate	23063330
Nasopharyngeal Carcinoma	Associate	11222718, 12634372, 12865928
Neoplasm Metastasis	Associate	16741510, 21964595, 23915238, 25137041, 35502613
Neoplasm Metastasis	Inhibit	36862902
Neoplasms	Associate	11222718, 12208876, 12865928, 15686596, 16741510, 17015686, 18835035, 19709433, 19812686, 19893034, 20339477, 20854925, 21091189, 21234733, 22081596 View all (33 more)
Neoplasms	Inhibit	11418694, 26491227, 33155364, 40003884
Neoplasms	Stimulate	15498775, 27035235
Nephrotic Syndrome	Associate	28433687, 35734930
Neural Tube Defects	Associate	38563187
Neuroblastoma	Associate	18325115, 31475882
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	11146160
Noonan Syndrome	Associate	26456833
Obesity	Associate	17030965
Osteoarthritis	Associate	33879632
Osteomyelitis	Associate	32954739
Osteoporosis	Stimulate	40496565
Ovarian Neoplasms	Associate	20585448, 28536310, 36276992
Pancreatic Neoplasms	Associate	33099939
Parkinson Disease	Associate	34536521
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	22523564
Peri Implantitis	Associate	36193198
Philadelphia Chromosome	Associate	36076986
Polycythemia	Associate	38629639
Polycythemia primary familial and congenital	Associate	10498627
Polycythemia Vera	Associate	16684963, 21355091, 38563187, 38629639
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	22685175, 22895079, 34157051
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	26785729, 27322685, 30185437, 32667731, 35734930, 35805156
Primary Myelofibrosis	Associate	23386690, 31369569
Prolactinoma	Associate	30445560
Prostatic Hyperplasia	Associate	28216616
Prostatic Neoplasms	Associate	12719422, 19567780, 20053773, 20854925, 20966544, 22081596, 23026195, 25552366, 31292140, 32397189, 32790723
Prostatitis	Associate	20966544
Pulmonary Disease Chronic Obstructive	Associate	34206428
Purpura	Associate	25736842
Renal Insufficiency Chronic	Associate	29619880
Secretory breast carcinoma	Associate	26252941
Severe Combined Immunodeficiency	Associate	30032486
Sezary Syndrome	Associate	25779945
Sjogren's Syndrome	Stimulate	25736842
Sjogren's Syndrome	Inhibit	30150979
Sjogren's Syndrome	Associate	36072585
Smooth Muscle Tumor	Associate	33590796
Squamous Cell Carcinoma of Head and Neck	Associate	12771142, 24192080, 27038552, 36097539
Status Asthmaticus	Associate	22970180
Stomach Neoplasms	Associate	31646566, 32086862
T Lymphocytopenia Idiopathic CD4 Positive	Inhibit	22454463
T Lymphocytopenia Idiopathic CD4 Positive	Associate	23383227
Tetralogy of Fallot	Associate	28329231
Tuberculosis	Associate	30886421
Tyrosine Kinase 2 Deficiency	Stimulate	34635505, 34811450
Urinary Bladder Neoplasms	Associate	29517678
Uterine Cervical Dysplasia	Associate	39684873
Uterine Cervical Neoplasms	Associate	35492074
Waldenstrom Macroglobulinemia	Associate	24335105
Wells syndrome	Associate	37342057
X Linked Combined Immunodeficiency Diseases	Associate	35052377, 35941390

STAT5A (signal transducer and activator of transcription 5A)