Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
117178
Gene name Gene Name - the full gene name approved by the HGNC.
SSX family member 2 interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SSX2IP
Synonyms (NCBI Gene) Gene synonyms aliases
ADIP, hMsd1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that binds the cancer-testis antigen Synovial Sarcoma X breakpoint 2 protein. The encoded protein may regulate the activity of Synovial Sarcoma X breakpoint 2 protein in malignant cells. Alternate splicing results in multiple t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016383 hsa-miR-193b-3p Microarray 20304954
MIRT020713 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT049125 hsa-miR-92a-3p CLASH 23622248
MIRT042758 hsa-miR-339-5p CLASH 23622248
MIRT053144 hsa-miR-222-3p Luciferase reporter assay, qRT-PCR 23776679
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 12007189, 21516116, 21988832, 22458338, 24397932, 25416956, 25910212, 26545777, 26638075, 26675238, 26871637, 31515488, 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005912 Component Adherens junction IEA
GO:0007098 Process Centrosome cycle IMP 23816619
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608690 16509 ENSG00000117155
Protein
UniProt ID Q9Y2D8
Protein name Afadin- and alpha-actinin-binding protein (ADIP) (Afadin DIL domain-interacting protein) (SSX2-interacting protein)
Protein function Belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). May connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be in
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11559 ADIP 63 214 Afadin- and alpha -actinin-Binding Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with the highest expression in brain, intermediate expression in kidney, testis, spinal cord, liver, heart, lung, skeletal muscle, ovary, fetal liver and fetal brain, and little to no expression in pancreas and spleen
Sequence
MGDWMTVTDPGLSSESKTISQYTSETKMSPSSLYSQQVLCSSIPLSKNVHSFFSAFCTED
NIEQSISYLDQELTTFGFPSLYEESKGKETKRELNIVAVLNCMNELLVLQRKNLLAQENV
ETQNLKLGSDMDHLQSCYSKLKEQLETSRREMIGLQERDRQLQCKNRNLHQLLKNEKDEV
QKLQNIIASRATQYNHDMKRKEREYNKLKERLHQ
LVMNKKDKKIAMDILNYVGRADGKRG
SWRTGKTEARNEDEMYKILLNDYEYRQKQILMENAELKKVLQQMKKEMISLLSPQKKKPR
ERVDDSTGTVISDVEEDAGELSRESMWDLSCETVREQLTNSIRKQWRILKSHVEKLDNQV
SKVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATAYDDDTTSLL
RDCYLLEEKERLKEEWSLFKEQKKNFERERRSFTEAAIRLGLERKAFEEERASWLKQQFL
NMTTFDHQNSENVKLFSAFSGSSDWDNLIVHSRQPQKKPHSVSNGSPVCMSKLTKSLPAS
PSTSDFCQTRSCISEHSSINVLNITAEEIKPNQVGGECTNQKWSVASRPGSQEGCYSGCS
LSYTNSHVEKDDLP
Sequence length 614
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Dental caries Dental caries GWAS
Dementia Dementia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinogenesis Associate 23452395
Carcinoma Hepatocellular Associate 23452395
Leukemia Associate 23452395
Neoplasm Metastasis Stimulate 23452395
Neoplasms Stimulate 23452395
Sarcoma Synovial Associate 23452395
Thrombosis Associate 23452395