Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6720
Gene name	Sterol regulatory element binding transcription factor 1
Gene symbol	SREBF1
Synonyms (NCBI Gene)	HMDIFAP2SREBP1bHLHd1
Chromosome	17
Chromosome location	17p11.2
Summary	This gene encodes a basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a motif that is found in the promoter of the low density lipoprotein receptor gene and other genes inv

333

Show/Hide all (333)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018325	hsa-miR-335-5p	Microarray	18185580
MIRT051418	hsa-let-7e-5p	CLASH	23622248
MIRT050226	hsa-miR-25-3p	CLASH	23622248
MIRT047574	hsa-miR-10a-5p	CLASH	23622248
MIRT045315	hsa-miR-185-5p	CLASH	23622248
MIRT043859	hsa-miR-378a-3p	CLASH	23622248
MIRT041670	hsa-miR-484	CLASH	23622248
MIRT038739	hsa-miR-93-3p	CLASH	23622248
MIRT037474	hsa-miR-744-5p	CLASH	23622248
MIRT054225	hsa-miR-128-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23990020
MIRT054225	hsa-miR-128-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23990020
MIRT054666	hsa-miR-33a-5p	qRT-PCRWestern blot	24300912
MIRT045315	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	23951060
MIRT438066	hsa-miR-342-3p	Luciferase reporter assayqRT-PCRWestern blot	23951060
MIRT045315	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	23951060
MIRT438066	hsa-miR-342-3p	Luciferase reporter assayqRT-PCRWestern blot	23951060
MIRT721601	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT721600	hsa-miR-5688	HITS-CLIP	19536157
MIRT721599	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT721598	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT721597	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT721597	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT721596	hsa-miR-4301	HITS-CLIP	19536157
MIRT721595	hsa-miR-4286	HITS-CLIP	19536157
MIRT721594	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT721593	hsa-miR-4290	HITS-CLIP	19536157
MIRT721592	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT721591	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT527532	hsa-miR-95-5p	PAR-CLIP	22012620
MIRT527531	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT487335	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	23592263
MIRT487333	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487329	hsa-miR-4271	PAR-CLIP	23592263
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT487326	hsa-miR-663b	PAR-CLIP	23592263
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	23592263
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	23592263
MIRT439142	hsa-let-7c-5p	3'LIFE	25074381
MIRT439117	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439142	hsa-let-7c-5p	3'LIFE	25074381
MIRT439117	hsa-miR-10b-5p	3'LIFE	25074381
MIRT721601	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT721600	hsa-miR-5688	HITS-CLIP	19536157
MIRT721599	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT721598	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT721597	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT721597	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT721596	hsa-miR-4301	HITS-CLIP	19536157
MIRT721595	hsa-miR-4286	HITS-CLIP	19536157
MIRT721594	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT721593	hsa-miR-4290	HITS-CLIP	19536157
MIRT721592	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT721591	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT527532	hsa-miR-95-5p	PAR-CLIP	22012620
MIRT527531	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT487335	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	23592263
MIRT487333	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487329	hsa-miR-4271	PAR-CLIP	23592263
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT487326	hsa-miR-663b	PAR-CLIP	23592263
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	23592263
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	23592263
MIRT1387947	hsa-miR-1323	CLIP-seq
MIRT1387948	hsa-miR-142-5p	CLIP-seq
MIRT1387949	hsa-miR-18a	CLIP-seq
MIRT1387950	hsa-miR-18b	CLIP-seq
MIRT1387951	hsa-miR-296-5p	CLIP-seq
MIRT1387952	hsa-miR-3148	CLIP-seq
MIRT1387953	hsa-miR-3173-3p	CLIP-seq
MIRT1387954	hsa-miR-3647-3p	CLIP-seq
MIRT1387955	hsa-miR-4459	CLIP-seq
MIRT1387956	hsa-miR-4698	CLIP-seq
MIRT1387957	hsa-miR-4735-3p	CLIP-seq
MIRT1387958	hsa-miR-4779	CLIP-seq
MIRT1387959	hsa-miR-513c	CLIP-seq
MIRT1387960	hsa-miR-514b-5p	CLIP-seq
MIRT1387961	hsa-miR-548o	CLIP-seq
MIRT1387962	hsa-miR-561	CLIP-seq
MIRT1387963	hsa-miR-1234	CLIP-seq
MIRT1387964	hsa-miR-1275	CLIP-seq
MIRT1387965	hsa-miR-1286	CLIP-seq
MIRT1387947	hsa-miR-1323	CLIP-seq
MIRT1387948	hsa-miR-142-5p	CLIP-seq
MIRT1387949	hsa-miR-18a	CLIP-seq
MIRT1387950	hsa-miR-18b	CLIP-seq
MIRT1387966	hsa-miR-1910	CLIP-seq
MIRT1387967	hsa-miR-2467-3p	CLIP-seq
MIRT1387968	hsa-miR-3158-5p	CLIP-seq
MIRT1387953	hsa-miR-3173-3p	CLIP-seq
MIRT1387969	hsa-miR-330-3p	CLIP-seq
MIRT1387970	hsa-miR-3612	CLIP-seq
MIRT1387954	hsa-miR-3647-3p	CLIP-seq
MIRT1387971	hsa-miR-3678-3p	CLIP-seq
MIRT1387972	hsa-miR-3690	CLIP-seq
MIRT1387973	hsa-miR-377	CLIP-seq
MIRT1387974	hsa-miR-3973	CLIP-seq
MIRT1387975	hsa-miR-4254	CLIP-seq
MIRT1387976	hsa-miR-4297	CLIP-seq
MIRT1387977	hsa-miR-4325	CLIP-seq
MIRT1387978	hsa-miR-4436a	CLIP-seq
MIRT1387979	hsa-miR-4443	CLIP-seq
MIRT1387980	hsa-miR-4446-5p	CLIP-seq
MIRT1387981	hsa-miR-450b-5p	CLIP-seq
MIRT1387982	hsa-miR-4525	CLIP-seq
MIRT1387983	hsa-miR-455-3p	CLIP-seq
MIRT1387984	hsa-miR-4665-3p	CLIP-seq
MIRT1387985	hsa-miR-4665-5p	CLIP-seq
MIRT1387986	hsa-miR-4723-5p	CLIP-seq
MIRT1387987	hsa-miR-4731-5p	CLIP-seq
MIRT1387957	hsa-miR-4735-3p	CLIP-seq
MIRT1387988	hsa-miR-4755-5p	CLIP-seq
MIRT1387989	hsa-miR-4763-5p	CLIP-seq
MIRT1387958	hsa-miR-4779	CLIP-seq
MIRT1387959	hsa-miR-513c	CLIP-seq
MIRT1387960	hsa-miR-514b-5p	CLIP-seq
MIRT1387990	hsa-miR-518a-5p	CLIP-seq
MIRT1387991	hsa-miR-527	CLIP-seq
MIRT1387992	hsa-miR-548an	CLIP-seq
MIRT1387961	hsa-miR-548o	CLIP-seq
MIRT1387993	hsa-miR-550a	CLIP-seq
MIRT1387962	hsa-miR-561	CLIP-seq
MIRT1387994	hsa-miR-625	CLIP-seq
MIRT1387995	hsa-miR-637	CLIP-seq
MIRT1387996	hsa-miR-650	CLIP-seq
MIRT1387963	hsa-miR-1234	CLIP-seq
MIRT1387969	hsa-miR-330-3p	CLIP-seq
MIRT1387976	hsa-miR-4297	CLIP-seq
MIRT1387984	hsa-miR-4665-3p	CLIP-seq
MIRT2116230	hsa-miR-1233	CLIP-seq
MIRT2116231	hsa-miR-150	CLIP-seq
MIRT2116232	hsa-miR-185	CLIP-seq
MIRT2116233	hsa-miR-3065-3p	CLIP-seq
MIRT2116234	hsa-miR-3153	CLIP-seq
MIRT2116235	hsa-miR-326	CLIP-seq
MIRT2116236	hsa-miR-330-5p	CLIP-seq
MIRT1387970	hsa-miR-3612	CLIP-seq
MIRT2116237	hsa-miR-4306	CLIP-seq
MIRT1387979	hsa-miR-4443	CLIP-seq
MIRT2116238	hsa-miR-4487	CLIP-seq
MIRT2116239	hsa-miR-4497	CLIP-seq
MIRT2116240	hsa-miR-4644	CLIP-seq
MIRT2116241	hsa-miR-4667-5p	CLIP-seq
MIRT2116242	hsa-miR-4695-5p	CLIP-seq
MIRT2116243	hsa-miR-4700-5p	CLIP-seq
MIRT2116244	hsa-miR-4713-5p	CLIP-seq
MIRT2116245	hsa-miR-4757-5p	CLIP-seq
MIRT2116246	hsa-miR-486-3p	CLIP-seq
MIRT1387995	hsa-miR-637	CLIP-seq
MIRT1387996	hsa-miR-650	CLIP-seq
MIRT2116247	hsa-miR-662	CLIP-seq
MIRT2338765	hsa-miR-1236	CLIP-seq
MIRT1387947	hsa-miR-1323	CLIP-seq
MIRT2116233	hsa-miR-3065-3p	CLIP-seq
MIRT2338766	hsa-miR-3137	CLIP-seq
MIRT1387952	hsa-miR-3148	CLIP-seq
MIRT2338767	hsa-miR-3183	CLIP-seq
MIRT2338768	hsa-miR-339-5p	CLIP-seq
MIRT2338769	hsa-miR-4257	CLIP-seq
MIRT1387976	hsa-miR-4297	CLIP-seq
MIRT2338770	hsa-miR-4421	CLIP-seq
MIRT1387955	hsa-miR-4459	CLIP-seq
MIRT2338771	hsa-miR-4672	CLIP-seq
MIRT2338772	hsa-miR-4723-3p	CLIP-seq
MIRT2338773	hsa-miR-486-5p	CLIP-seq
MIRT1387959	hsa-miR-513c	CLIP-seq
MIRT1387960	hsa-miR-514b-5p	CLIP-seq
MIRT1387961	hsa-miR-548o	CLIP-seq
MIRT2338774	hsa-miR-670	CLIP-seq
MIRT2395152	hsa-miR-4649-3p	CLIP-seq
MIRT2116230	hsa-miR-1233	CLIP-seq
MIRT1387963	hsa-miR-1234	CLIP-seq
MIRT2632205	hsa-miR-1289	CLIP-seq
MIRT2116231	hsa-miR-150	CLIP-seq
MIRT2116232	hsa-miR-185	CLIP-seq
MIRT2116234	hsa-miR-3153	CLIP-seq
MIRT2632206	hsa-miR-3173-5p	CLIP-seq
MIRT2632207	hsa-miR-3198	CLIP-seq
MIRT2116235	hsa-miR-326	CLIP-seq
MIRT2116236	hsa-miR-330-5p	CLIP-seq
MIRT2632208	hsa-miR-4270	CLIP-seq
MIRT2632209	hsa-miR-4294	CLIP-seq
MIRT2116237	hsa-miR-4306	CLIP-seq
MIRT2632210	hsa-miR-4309	CLIP-seq
MIRT2632211	hsa-miR-4327	CLIP-seq
MIRT2632212	hsa-miR-4441	CLIP-seq
MIRT2632213	hsa-miR-4480	CLIP-seq
MIRT2116239	hsa-miR-4497	CLIP-seq
MIRT2116240	hsa-miR-4644	CLIP-seq
MIRT2116241	hsa-miR-4667-5p	CLIP-seq
MIRT2116243	hsa-miR-4700-5p	CLIP-seq
MIRT2632214	hsa-miR-4704-5p	CLIP-seq
MIRT2116244	hsa-miR-4713-5p	CLIP-seq
MIRT2632215	hsa-miR-4715-5p	CLIP-seq
MIRT2116245	hsa-miR-4757-5p	CLIP-seq
MIRT2632216	hsa-miR-4785	CLIP-seq
MIRT2116246	hsa-miR-486-3p	CLIP-seq
MIRT1387995	hsa-miR-637	CLIP-seq
MIRT2116247	hsa-miR-662	CLIP-seq
MIRT2116230	hsa-miR-1233	CLIP-seq
MIRT1387963	hsa-miR-1234	CLIP-seq
MIRT2632205	hsa-miR-1289	CLIP-seq
MIRT2116231	hsa-miR-150	CLIP-seq
MIRT2116232	hsa-miR-185	CLIP-seq
MIRT2116234	hsa-miR-3153	CLIP-seq
MIRT2632206	hsa-miR-3173-5p	CLIP-seq
MIRT2632207	hsa-miR-3198	CLIP-seq
MIRT2116235	hsa-miR-326	CLIP-seq
MIRT2116236	hsa-miR-330-5p	CLIP-seq
MIRT2632208	hsa-miR-4270	CLIP-seq
MIRT2632209	hsa-miR-4294	CLIP-seq
MIRT2116237	hsa-miR-4306	CLIP-seq
MIRT2632210	hsa-miR-4309	CLIP-seq
MIRT2632211	hsa-miR-4327	CLIP-seq
MIRT2632212	hsa-miR-4441	CLIP-seq
MIRT2632213	hsa-miR-4480	CLIP-seq
MIRT2116239	hsa-miR-4497	CLIP-seq
MIRT2116240	hsa-miR-4644	CLIP-seq
MIRT2116241	hsa-miR-4667-5p	CLIP-seq
MIRT2116243	hsa-miR-4700-5p	CLIP-seq
MIRT2632214	hsa-miR-4704-5p	CLIP-seq
MIRT2116244	hsa-miR-4713-5p	CLIP-seq
MIRT2632215	hsa-miR-4715-5p	CLIP-seq
MIRT2116245	hsa-miR-4757-5p	CLIP-seq
MIRT2632216	hsa-miR-4785	CLIP-seq
MIRT2116246	hsa-miR-486-3p	CLIP-seq
MIRT1387995	hsa-miR-637	CLIP-seq
MIRT2116247	hsa-miR-662	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
SP1	Activation	20179320
SP1	Unknown	15462672

108

Show/Hide all (108)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	23610160
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	12177166, 32322062
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	32497488
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	14701856
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	24296663, 31501273
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003062	Process	Regulation of heart rate by chemical signal	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	16407292
GO:0004879	Function	Nuclear receptor activity	IDA	23610160
GO:0005515	Function	Protein binding	IPI	16713569, 16799563, 18385733, 20817729, 21993218, 23610160, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12202038, 15358760, 32322062
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	32497488
GO:0005634	Component	Nucleus	TAS	8156598
GO:0005635	Component	Nuclear envelope	TAS	8156598
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	12202038
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	8156598
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	32322062
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8156598
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	8156598
GO:0006695	Process	Cholesterol biosynthetic process	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0008610	Process	Lipid biosynthetic process	IMP	32497488
GO:0008610	Process	Lipid biosynthetic process	ISS
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009267	Process	Cellular response to starvation	ISS	16407292
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0009750	Process	Response to fructose	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	ISS
GO:0012507	Component	ER to Golgi transport vesicle membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019217	Process	Regulation of fatty acid metabolic process	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030073	Process	Insulin secretion	IEA
GO:0030324	Process	Lung development	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031647	Process	Regulation of protein stability	IMP	24912190
GO:0032094	Process	Response to food	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032810	Function	Sterol response element binding	IDA	16407292, 31501273
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032933	Process	SREBP signaling pathway	IDA	27614840, 32322062
GO:0032933	Process	SREBP signaling pathway	IEA
GO:0032933	Process	SREBP signaling pathway	IMP	27614840
GO:0032991	Component	Protein-containing complex	IEA
GO:0033762	Process	Response to glucagon	IEA
GO:0033993	Process	Response to lipid	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	12177166, 32322062
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IEA
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IEA
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IMP	12177166
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12242332, 26437365, 31501273
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	23610160
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	23610160
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0070542	Process	Response to fatty acid	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0090209	Process	Negative regulation of triglyceride metabolic process	IDA	28483554
GO:1901524	Process	Regulation of mitophagy	IMP	24912190
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	24296663, 31501273
GO:1903214	Process	Regulation of protein targeting to mitochondrion	IMP	24912190
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
184756	11289	ENSG00000072310

P36956

Protein name

Sterol regulatory element-binding protein 1 (SREBP-1) (Class D basic helix-loop-helix protein 1) (bHLHd1) (Sterol regulatory element-binding transcription factor 1) [Cleaved into: Processed sterol regulatory element-binding protein 1 (Transcription factor

Protein function

[Sterol regulatory element-binding protein 1]: Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane (PubMed:32322062). Low sterol concentratio

PDB

1AM9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	324 → 374	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of tissues, most abundant in liver and adrenal gland (PubMed:8402897). In fetal tissues lung and liver shows highest expression (PubMed:8402897). {ECO:0000269|PubMed:8402897}.; TISSUE SPECIFICITY: [Isoform S

Sequence

MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTD
PASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGP
GIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGN
TQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLL
QPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDA
EKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKS
AVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE
VEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR
GMLDRSRLALCTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGW
AQWLLPPVVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQ
AAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRV
DASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSALNLAECAGDAVSVATLAEIYV
AAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDWSVL
STPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYL
QLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
VEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTP
ASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSS
LRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGKGGAVAELEPR
PTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMRLGG
GTTVTSS

Sequence length

1147

Interactions

View interactions

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hereditary mucoepithelial dysplasia	Likely pathogenic; Pathogenic	rs1045239575, rs2033690347, rs1428621525	RCV003990155 RCV001260974 RCV001260975
IFAP syndrome 1, with or without BRESHECK syndrome	Pathogenic	rs2033690347, rs2033689385, rs2033688284	RCV001263099 RCV001263100 RCV001263101
IFAP syndrome 2	Pathogenic	rs2033690347, rs2033689385, rs2033688284	RCV001255643 RCV001255644 RCV001255645

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Uncertain significance	rs371518920	RCV005939230
Obesity	Conflicting classifications of pathogenicity	rs201090006	RCV003223519
Ovarian serous cystadenocarcinoma	Uncertain significance	rs147603937, rs142115026	RCV005929052 RCV005939231
SREBF1-related disorder	Uncertain significance	rs766119997	RCV003419072

Show/Hide Text Mining Associations (112)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acrocephalosyndactylia	Associate	31490983
Atherosclerosis	Associate	19292868, 23717417, 31610782, 40527779
Atrophy	Associate	23226416
Azoospermia Nonobstructive	Inhibit	24842676
Breast Neoplasms	Associate	23082122, 31073170, 34575972, 36960852
Carcinogenesis	Associate	36087034
Carcinoma Hepatocellular	Associate	20173757, 24776759, 34311471, 34981667, 37828054
Carcinoma Non Small Cell Lung	Associate	32568455, 33939316, 35806291
Carcinoma Ovarian Epithelial	Associate	36512324
Carcinoma Pancreatic Ductal	Associate	28521289
Carcinoma Renal Cell	Associate	33647481, 34285190, 36694250
Cardiovascular Diseases	Associate	23680128, 35652342
Carotid Stenosis	Associate	31610782
Cell Transformation Neoplastic	Associate	29328367
Chemical and Drug Induced Liver Injury	Associate	24152445
Colonic Neoplasms	Stimulate	31299935
Colorectal Neoplasms	Associate	16817902, 31299935, 31601152, 36348128
Congenital Hyperinsulinism	Stimulate	20699619
Coronary Artery Disease	Associate	28095459, 28367087, 36380121, 39614436
Coronary Artery Disease	Inhibit	31610782
Coronary Artery Disease	Stimulate	32323776
Coronary Disease	Associate	23840567, 39953634
COVID 19	Stimulate	37669865
Dementia	Associate	20167577
Diabetes Gestational	Associate	38326276
Diabetes Mellitus	Associate	17019602, 18654640, 26095709, 28521289, 31169416, 36529747
Diabetes Mellitus Type 2	Associate	14742839, 17019602, 19292868, 19720801, 24614076, 26095709, 27148772, 30600310, 31169416, 31506343, 32041280, 32710190, 36529747
Diabetes Mellitus Type 2	Inhibit	17030965, 18448614
Dyslipidemias	Associate	19913854, 27301461, 35899893
Dyslipidemias	Stimulate	31299935
Embolism Fat	Associate	30845774, 33207858
Endocrine System Diseases	Associate	30180878
Endometrial Neoplasms	Associate	22672904, 24105476, 24614076, 34039951, 37305395
Endometrial Neoplasms	Stimulate	24614076, 28176325
Endotoxemia	Inhibit	30422702
Fatty Liver	Associate	19733654, 23103837, 24603540, 32332706, 35152538, 37385614
Fatty Liver	Stimulate	25406988, 33096687
Fibrosis	Associate	39941038
Gait Ataxia	Associate	24514572
Gerstmann Syndrome	Associate	31159817, 35162967, 37572939
Glioma	Associate	24077277, 35894143
Glomerulonephritis IGA	Associate	35769467
Glucosephosphate Dehydrogenase Deficiency	Inhibit	33485183
Hearing Loss	Associate	26095709
Hepatitis C	Stimulate	24478438, 27193023
Hyperinsulinism	Associate	22471940, 27301461
Hyperlipidemias	Associate	27777315
Hyperlipoproteinemia Type II	Associate	33028190
Hypertriglyceridemia	Associate	27301461
Ichthyosis follicularis atrichia photophobia syndrome	Associate	32497488
Inflammation	Inhibit	26718495
Inflammatory Bowel Diseases	Associate	35769467
Insulin Resistance	Associate	18654640, 19733654, 19913854, 21701566, 35417665
Iron Overload	Stimulate	21114893
Leukoencephalopathies	Associate	31691183
Lipodystrophy	Associate	21993218
Lipodystrophy Familial Partial	Associate	21993218
Liver Cirrhosis	Associate	24152445
Liver Failure	Associate	24152445
Lung Neoplasms	Stimulate	35806291
Lung Neoplasms	Associate	36087034
Lymphatic Metastasis	Stimulate	24776759, 34799559
Lymphatic Metastasis	Associate	31887541, 36171622
Melanoma	Associate	30970006, 31316083
Metabolic Diseases	Associate	22848045, 33978191, 34526523, 35843982
Metabolic Syndrome	Associate	26771965, 27301461, 28095459, 34780523, 39294274, 40243421
Multiple Myeloma	Associate	34378191
Multiple Sclerosis	Associate	39953634
Muscle Rigidity	Associate	24514572
Muscular Atrophy	Stimulate	23226416
Myotonic Dystrophy	Stimulate	30845774
Nasopharyngeal Carcinoma	Associate	34546840, 35628510
Neoplasm Invasiveness	Stimulate	34799559
Neoplasm Metastasis	Associate	24776759, 32464305, 39851231
Neoplasms	Associate	11082286, 22690709, 28617309, 29514980, 31118427, 31299935, 31379107, 31887541, 32464305, 34116604, 34272396, 34575972, 35534729, 35710732, 35894143, 39215079 View all (1 more)
Neoplasms	Stimulate	22672904, 24776759, 35806291, 37090107
Neoplasms Adipose Tissue	Associate	22309242, 28095459, 30425339, 32901515, 35417665
Neoplasms Squamous Cell	Associate	34272396
Non alcoholic Fatty Liver Disease	Associate	23985808, 25634759, 27572914, 28902428, 30948912, 33671486, 34808393, 36771140
Non alcoholic Fatty Liver Disease	Stimulate	32332706
Norrie disease	Associate	32041280
Obesity	Associate	11707537, 15833942, 17030965, 19292868, 19733654, 24614076, 27467133, 30422702, 35417665, 36529747, 37106328, 37385614
Obesity	Stimulate	19913854, 30845774, 34526523
Osteoarthritis	Associate	34899727
Osteosarcoma	Associate	31736227
Pancreatitis	Inhibit	15833942
Parkinson Disease	Associate	21738487, 24514572
Periodontal Diseases	Associate	28083517
Phyllodes Tumor of the Prostate	Associate	33807257
Polycystic Ovary Syndrome	Stimulate	28176325, 31618328
Polycystic Ovary Syndrome	Associate	37445796, 39294274
Potocki Lupski syndrome	Associate	28413209
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	37072664
Progeria	Associate	21993218
Prostatic Neoplasms	Associate	18774944, 20025723, 22540830, 25294820, 29784665, 31395683, 32258129, 33471067, 33780364, 34948018, 38279172
Prostatic Neoplasms Castration Resistant	Associate	25880275
Reperfusion Injury	Associate	36840630
Schizophrenia	Associate	24329191, 25433960
Sitosterolemia	Associate	9610773
Sleep Apnea Obstructive	Associate	30600310
Sleep Deprivation	Associate	25197809
Smith Magenis Syndrome	Associate	12180145
Squamous Cell Carcinoma of Head and Neck	Stimulate	37090107
Stomach Neoplasms	Associate	32464305, 36171622
Tertiary Lymphoid Structures	Stimulate	37090107
Thyroid Neoplasms	Associate	31887541, 38436206
Thyroid Nodule	Stimulate	31887541
Tremor	Associate	24514572
Urinary Bladder Neoplasms	Associate	34116604, 35685866, 37542643
Weight Loss	Stimulate	11707537
Weight Loss	Associate	19913854
Weight Loss	Inhibit	34526523

SREBF1 (sterol regulatory element binding transcription factor 1)