SPI1 (Spi-1 proto-oncogene)

Gene
Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6688
Gene name Gene Name - the full gene name approved by the HGNC.
Spi-1 proto-oncogene
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPI1
Synonyms (NCBI Gene) Gene synonyms aliases
AGM10, OF, PU.1, SFPI1, SPI-1, SPI-A
Disease Acronyms (UniProt) Disease acronyms from UniProt database
AGM10
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regul
miRNA miRNA information provided by mirtarbase database.
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all(105)
miRTarBase ID miRNA Experiments Reference
MIRT004282 hsa-miR-155-5p Luciferase reporter assay 19386588
MIRT004282 hsa-miR-155-5p Luciferase reporter assay 19386588
MIRT004629 hsa-miR-342-3p Review 20026422
MIRT004827 hsa-miR-569 Luciferase reporter assay 21360505
MIRT005724 hsa-miR-34a-5p Luciferase reporter assay 20598588
Transcription factors
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all(10)
Transcription factor Regulation Reference
CEBPA Unknown 24429361
CEBPE Repression 12202480
FOS Repression 9988737
GATA1 Repression 10753833
GATA2 Repression 19620289
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all(48)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IDA 15304486
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 20139074
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs Transcription factors Other IDs Associated diseases
MIM HGNC e!Ensembl
165170 11241 ENSG00000066336
Protein
Gene SNPs Transcription factors Other IDs Associated diseases
UniProt ID P17947
Protein name Transcription factor PU.1 (31 kDa-transforming protein)
Protein function Pioneer transcription factor, which controls hematopoietic cell fate by decompacting stem cell heterochromatin and allowing other transcription factors to enter otherwise inaccessible genomic sites. Once in open chromatin, can directly control g
PDB 8E3K , 8E3R , 8E4H , 8E5Y , 8EBH , 8EE9 , 8EJ6 , 8EJ8 , 8EK3 , 8EK8 , 8EKJ , 8EKU , 8EKV , 8EKZ , 8EM9 , 8EMD , 8ENG , 8EO1 , 8EO4 , 8EQG , 8EQK , 8EQL , 8T9U , 8UFF , 8UFK , 8UFZ , 8UHK , 8V9N , 8VDH , 8VDI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00178 Ets 171 → 253 Ets-domain Domain
Tissue specificity TISSUE SPECIFICITY: In the bone marrow, concentrated in hematopoietic stem cell, lymphoid progenitor, myeloid lineage (granulocyte macrophage progenitors, classical dendritic cells, monocytes) and B-cell clusters. Among B-cells, predominantly expressed in
Sequence 
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQ
YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLL
RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
VKKVKKKLTYQFSGEVLGRGGLAERRHPPH
Sequence length 270
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide Unknown Diseases (9)
Unknown
Disease term Disease name Evidence References Source
Agammaglobulinemia agammaglobulinemia 10, autosomal dominant GenCC
Alzheimer disease Alzheimer disease GWAS
Neuroticism Neuroticism GWAS
Kidney Disease Kidney Disease GWAS
Show/Hide Text Mining Associations (152)
Associations from Text Mining
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 16938118
Acrocephalosyndactylia Stimulate 24453425
Adenocarcinoma of Lung Associate 28388536, 35675043
Agammaglobulinemia Associate 33951726
Alcoholism Associate 34417470
Alzheimer Disease Associate 29482603, 30124174, 32152295, 33712570, 34103633, 35253752, 35383839, 35436980, 35715361, 35931864, 36550123, 37253165, 37735671, 37774680, 40037709
Amyotrophic Lateral Sclerosis 2 Juvenile Associate 30224357
Aortic Aneurysm Abdominal Associate 34814367
Arthritis Stimulate 29979448
Arthritis Rheumatoid Associate 24213554, 27671860, 30123050, 31785408