Gene Gene information from NCBI Gene database.
Entrez ID 9021
Gene name Suppressor of cytokine signaling 3
Gene symbol SOCS3
Synonyms (NCBI Gene)
ATOD4CIS3Cish3SOCS-3SSI-3SSI3
Chromosome 17
Chromosome location 17q25.3
Summary This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced
miRNA miRNA information provided by mirtarbase database.
455
miRTarBase ID miRNA Experiments Reference
MIRT005062 hsa-miR-203a-3p ImmunohistochemistryIn situ hybridizationMicroarrayWestern blot 17622355
MIRT005062 hsa-miR-203a-3p Luciferase reporter assayqRT-PCRWestern blot 22207897
MIRT005062 hsa-miR-203a-3p Luciferase reporter assayqRT-PCRWestern blot 22207897
MIRT007129 hsa-miR-30c-5p qRT-PCR 23418453
MIRT054389 hsa-let-7f-5p Luciferase reporter assay 22894925
Transcription factors Transcription factors information provided by TRRUST V2 database.
8
Transcription factor Regulation Reference
CEBPA Activation 19332118
NFKB1 Unknown 23335796
RELA Unknown 23335796
SP3 Unknown 10570957
STAT1 Unknown 19115200
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0001784 Function Phosphotyrosine residue binding IEA
GO:0004860 Function Protein kinase inhibitor activity TAS 9266833
GO:0005126 Function Cytokine receptor binding IBA
GO:0005515 Function Protein binding IPI 19027008, 24728074, 25203322, 25416956, 32296183
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604176 19391 ENSG00000184557
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14543
Protein name Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (STAT-induced STAT inhibitor 3) (SSI-3)
Protein function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduc
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 46 127 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high expression in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney. Lower levels in thymus.
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHY
MPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Sequence length 225
Interactions View interactions