Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6591
Gene name	Snail family transcriptional repressor 2
Gene symbol	SNAI2
Synonyms (NCBI Gene)	SLUGSLUGHSLUGH1SNAIL2WS2D
Chromosome	8
Chromosome location	8q11.21
Summary	This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. T

311

Show/Hide all (311)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003273	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT003273	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT003273	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT002716	hsa-miR-124-3p	Microarray	15685193
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	ImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	ImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	ImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	ImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	ImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	ImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	23250910
MIRT007214	hsa-miR-1-3p	FlowImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	23142026
MIRT007214	hsa-miR-1-3p	FlowImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	23142026
MIRT007226	hsa-miR-182-5p	Luciferase reporter assay	23354685
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay	23354685
MIRT007240	hsa-miR-545-3p	Luciferase reporter assay	23434592
MIRT007240	hsa-miR-545-3p	Luciferase reporter assay	23434592
MIRT007241	hsa-miR-630	Luciferase reporter assay	23434592
MIRT007241	hsa-miR-630	Luciferase reporter assay	23434592
MIRT007241	hsa-miR-630	Luciferase reporter assay	23435373
MIRT019445	hsa-miR-148b-3p	Microarray	17612493
MIRT021454	hsa-miR-9-5p	Microarray	17612493
MIRT021687	hsa-miR-138-5p	Western blot;qRT-PCR	21770894
MIRT002716	hsa-miR-124-3p	Microarray	18668037
MIRT002716	hsa-miR-124-3p	Microarray	15685193
MIRT025178	hsa-miR-181a-5p	Microarray	17612493
MIRT054184	hsa-miR-128-3p	FlowqRT-PCRWestern blot	23019226
MIRT054282	hsa-miR-506-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25707493
MIRT054282	hsa-miR-506-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25707493
MIRT054282	hsa-miR-506-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25707493
MIRT054282	hsa-miR-506-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25707493
MIRT054282	hsa-miR-506-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25707493
MIRT054282	hsa-miR-506-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25707493
MIRT054282	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	23717581
MIRT054282	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	23717581
MIRT054655	hsa-miR-183-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	24277930
MIRT054656	hsa-miR-96-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	24277930
MIRT007214	hsa-miR-1-3p	ImmunofluorescenceImmunohistochemistryqRT-PCRWestern blot	24760686
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT439577	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439577	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731608	hsa-miR-489-3p	Luciferase reporter assay	26918943
MIRT731608	hsa-miR-489-3p	Luciferase reporter assay	26918943
MIRT731608	hsa-miR-489-3p	Luciferase reporter assay	26918943
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	26194864
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	26194864
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay	25871397
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay	25871397
MIRT007227	hsa-miR-203a-3p	qRT-PCRWestern blot	28269747
MIRT734121	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blotting	31570789
MIRT003273	hsa-miR-204-5p	Luciferase reporter assayWestern blottingMicroarrayImmunoprecipitaion (IP)Immunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	31938073
MIRT737441	hsa-miR-200b-3p	Luciferase reporter assayWestern blottingMicroarrayImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR	31749661
MIRT737442	hsa-miR-30c-1-3p	Luciferase reporter assayWestern blottingMicroarrayImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR	31749661
MIRT737443	hsa-miR-363-3p	Luciferase reporter assayWestern blottingMicroarrayImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR	31749661
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT755659	hsa-miR-203b-5p	Luciferase reporter assayWestern blottingqRT-PCR	37601756
MIRT755924	hsa-miR-429	Luciferase reporter assayWestern blottingqRT-PCR	34966442
MIRT1374793	hsa-miR-1271	CLIP-seq
MIRT1374794	hsa-miR-182	CLIP-seq
MIRT1374795	hsa-miR-300	CLIP-seq
MIRT1374796	hsa-miR-3065-5p	CLIP-seq
MIRT1374797	hsa-miR-380	CLIP-seq
MIRT1374798	hsa-miR-381	CLIP-seq
MIRT1374799	hsa-miR-3908	CLIP-seq
MIRT1374800	hsa-miR-421	CLIP-seq
MIRT1374801	hsa-miR-4495	CLIP-seq
MIRT1374802	hsa-miR-4666-3p	CLIP-seq
MIRT1374803	hsa-miR-885-3p	CLIP-seq
MIRT1374804	hsa-miR-96	CLIP-seq
MIRT1553874	hsa-miR-4795-3p	CLIP-seq
MIRT1553875	hsa-miR-656	CLIP-seq
MIRT2334640	hsa-miR-3662	CLIP-seq
MIRT2334641	hsa-miR-4477a	CLIP-seq
MIRT2334642	hsa-miR-4693-5p	CLIP-seq
MIRT2334643	hsa-miR-944	CLIP-seq
MIRT2433339	hsa-miR-1284	CLIP-seq
MIRT1374795	hsa-miR-300	CLIP-seq
MIRT1374798	hsa-miR-381	CLIP-seq
MIRT1374802	hsa-miR-4666-3p	CLIP-seq
MIRT2628670	hsa-miR-1236	CLIP-seq
MIRT2628671	hsa-miR-124	CLIP-seq
MIRT1374793	hsa-miR-1271	CLIP-seq
MIRT1374794	hsa-miR-182	CLIP-seq
MIRT2628672	hsa-miR-200b	CLIP-seq
MIRT2628673	hsa-miR-200c	CLIP-seq
MIRT2628674	hsa-miR-203	CLIP-seq
MIRT2628675	hsa-miR-2116	CLIP-seq
MIRT2628676	hsa-miR-218	CLIP-seq
MIRT2628677	hsa-miR-3128	CLIP-seq
MIRT2628678	hsa-miR-3153	CLIP-seq
MIRT2628679	hsa-miR-330-3p	CLIP-seq
MIRT2628680	hsa-miR-337-3p	CLIP-seq
MIRT2628681	hsa-miR-33a	CLIP-seq
MIRT2628682	hsa-miR-33b	CLIP-seq
MIRT2628683	hsa-miR-3622a-3p	CLIP-seq
MIRT2628684	hsa-miR-3622b-3p	CLIP-seq
MIRT2628685	hsa-miR-3673	CLIP-seq
MIRT2628686	hsa-miR-3714	CLIP-seq
MIRT1374797	hsa-miR-380	CLIP-seq
MIRT1374799	hsa-miR-3908	CLIP-seq
MIRT2628687	hsa-miR-3910	CLIP-seq
MIRT2628688	hsa-miR-3942-5p	CLIP-seq
MIRT755924	hsa-miR-429	CLIP-seq
MIRT2628689	hsa-miR-4476	CLIP-seq
MIRT2628690	hsa-miR-4477b	CLIP-seq
MIRT1374801	hsa-miR-4495	CLIP-seq
MIRT2628691	hsa-miR-452	CLIP-seq
MIRT2628692	hsa-miR-4668-5p	CLIP-seq
MIRT2628693	hsa-miR-4676-3p	CLIP-seq
MIRT2628694	hsa-miR-4677-5p	CLIP-seq
MIRT2628695	hsa-miR-4682	CLIP-seq
MIRT2628696	hsa-miR-4703-5p	CLIP-seq
MIRT2628697	hsa-miR-4720-5p	CLIP-seq
MIRT2628698	hsa-miR-4799-3p	CLIP-seq
MIRT2628699	hsa-miR-506	CLIP-seq
MIRT2628700	hsa-miR-520d-5p	CLIP-seq
MIRT2628701	hsa-miR-524-5p	CLIP-seq
MIRT2628702	hsa-miR-636	CLIP-seq
MIRT2628703	hsa-miR-651	CLIP-seq
MIRT1374803	hsa-miR-885-3p	CLIP-seq
MIRT2628704	hsa-miR-890	CLIP-seq
MIRT1374804	hsa-miR-96	CLIP-seq
MIRT2628671	hsa-miR-124	CLIP-seq
MIRT1374793	hsa-miR-1271	CLIP-seq
MIRT2433339	hsa-miR-1284	CLIP-seq
MIRT2691568	hsa-miR-137	CLIP-seq
MIRT1374794	hsa-miR-182	CLIP-seq
MIRT2628672	hsa-miR-200b	CLIP-seq
MIRT2628673	hsa-miR-200c	CLIP-seq
MIRT2628674	hsa-miR-203	CLIP-seq
MIRT2628675	hsa-miR-2116	CLIP-seq
MIRT2628676	hsa-miR-218	CLIP-seq
MIRT2691569	hsa-miR-25	CLIP-seq
MIRT1374795	hsa-miR-300	CLIP-seq
MIRT2628677	hsa-miR-3128	CLIP-seq
MIRT2691570	hsa-miR-3140-3p	CLIP-seq
MIRT2691571	hsa-miR-3179	CLIP-seq
MIRT2691572	hsa-miR-32	CLIP-seq
MIRT2691573	hsa-miR-3202	CLIP-seq
MIRT2691574	hsa-miR-323-3p	CLIP-seq
MIRT2628679	hsa-miR-330-3p	CLIP-seq
MIRT2628681	hsa-miR-33a	CLIP-seq
MIRT2628682	hsa-miR-33b	CLIP-seq
MIRT2691575	hsa-miR-3614-5p	CLIP-seq
MIRT2628683	hsa-miR-3622a-3p	CLIP-seq
MIRT2628684	hsa-miR-3622b-3p	CLIP-seq
MIRT2691576	hsa-miR-363	CLIP-seq
MIRT2691577	hsa-miR-367	CLIP-seq
MIRT2628685	hsa-miR-3673	CLIP-seq
MIRT2628686	hsa-miR-3714	CLIP-seq
MIRT1374797	hsa-miR-380	CLIP-seq
MIRT1374798	hsa-miR-381	CLIP-seq
MIRT1374799	hsa-miR-3908	CLIP-seq
MIRT2628687	hsa-miR-3910	CLIP-seq
MIRT2691578	hsa-miR-3936	CLIP-seq
MIRT2628688	hsa-miR-3942-5p	CLIP-seq
MIRT755924	hsa-miR-429	CLIP-seq
MIRT2628689	hsa-miR-4476	CLIP-seq
MIRT2628690	hsa-miR-4477b	CLIP-seq
MIRT1374801	hsa-miR-4495	CLIP-seq
MIRT2628691	hsa-miR-452	CLIP-seq
MIRT2691579	hsa-miR-4533	CLIP-seq
MIRT2691580	hsa-miR-4536	CLIP-seq
MIRT1374802	hsa-miR-4666-3p	CLIP-seq
MIRT2628693	hsa-miR-4676-3p	CLIP-seq
MIRT2628694	hsa-miR-4677-5p	CLIP-seq
MIRT2628695	hsa-miR-4682	CLIP-seq
MIRT2628696	hsa-miR-4703-5p	CLIP-seq
MIRT2628697	hsa-miR-4720-5p	CLIP-seq
MIRT1553874	hsa-miR-4795-3p	CLIP-seq
MIRT2628698	hsa-miR-4799-3p	CLIP-seq
MIRT2628699	hsa-miR-506	CLIP-seq
MIRT2628700	hsa-miR-520d-5p	CLIP-seq
MIRT2628701	hsa-miR-524-5p	CLIP-seq
MIRT2691581	hsa-miR-548an	CLIP-seq
MIRT2691582	hsa-miR-579	CLIP-seq
MIRT2691583	hsa-miR-586	CLIP-seq
MIRT2628702	hsa-miR-636	CLIP-seq
MIRT2628703	hsa-miR-651	CLIP-seq
MIRT1374803	hsa-miR-885-3p	CLIP-seq
MIRT2628704	hsa-miR-890	CLIP-seq
MIRT2691584	hsa-miR-92a	CLIP-seq
MIRT2691585	hsa-miR-92b	CLIP-seq
MIRT1374804	hsa-miR-96	CLIP-seq

Show/Hide all (16)

Transcription factor	Regulation	Reference
CREB1	Repression	15955695
ESRRA	Repression	15955695
EZH2	Repression	23836662
HDAC1	Repression	18588516
HDAC2	Repression	23836662
LEF1	Unknown	20128911
MTA1	Activation	18719363
NCOR1	Repression	18588516
PER2	Repression	23836662
POU2F1	Activation	23836662
POU2F1	Repression	23836662
RUNX2	Activation	22641097
SUZ12	Repression	23836662
TCF7	Unknown	20128911
TCF7L2	Unknown	20128911
WT1	Unknown	17430890

Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10866665, 11912130, 15737616, 16707493
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	17984306, 18663143
GO:0000785	Component	Chromatin	IDA	16707493, 19756381
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11912130
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	10866665, 11912130, 15737616, 16707493, 18663143
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001649	Process	Osteoblast differentiation	IEP	20128911
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IMP	9182671, 17984306
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	TAS	20951801
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	IEA
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	TAS	20951801
GO:0003273	Process	Cell migration involved in endocardial cushion formation	IEA
GO:0003273	Process	Cell migration involved in endocardial cushion formation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IDA	10866665, 25893292, 29910125
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006929	Process	Substrate-dependent cell migration	IEA
GO:0006933	Process	Negative regulation of cell adhesion involved in substrate-bound cell migration	IEA
GO:0007219	Process	Notch signaling pathway	IMP	18663143
GO:0007219	Process	Notch signaling pathway	TAS	20951801
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IMP	12444107
GO:0008270	Function	Zinc ion binding	IEA
GO:0009314	Process	Response to radiation	IEA
GO:0010631	Process	Epithelial cell migration	IEA
GO:0010839	Process	Negative regulation of keratinocyte proliferation	IDA	16707493
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IDA	18485278, 19502595
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IEA
GO:0014032	Process	Neural crest cell development	IMP	12444107
GO:0030335	Process	Positive regulation of cell migration	IMP	15314165
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IMP	19756381
GO:0032642	Process	Regulation of chemokine production	IMP	21182836
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033629	Process	Negative regulation of cell adhesion mediated by integrin	IDA	16707493
GO:0035921	Process	Desmosome disassembly	IEA
GO:0035921	Process	Desmosome disassembly	IMP	9182671
GO:0043473	Process	Pigmentation	IEA
GO:0043473	Process	Pigmentation	IMP	12444107
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IMP	15314165
GO:0043542	Process	Endothelial cell migration	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	10518215, 10866665
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045667	Process	Regulation of osteoblast differentiation	IMP	19756381, 21182836
GO:0046872	Function	Metal ion binding	IEA
GO:0048762	Process	Mesenchymal cell differentiation	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060429	Process	Epithelium development	IEA
GO:0060429	Process	Epithelium development	ISS	18716062
GO:0060536	Process	Cartilage morphogenesis	IEA
GO:0060693	Process	Regulation of branching involved in salivary gland morphogenesis	IEA
GO:0070563	Process	Negative regulation of vitamin D receptor signaling pathway	IDA	19502595
GO:0070888	Function	E-box binding	IDA	11912130, 15737616, 16707493
GO:0070888	Function	E-box binding	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	18716062
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	19502595
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	19756381
GO:1902034	Process	Negative regulation of hematopoietic stem cell proliferation	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	15314165
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000810	Process	Regulation of bicellular tight junction assembly	IEA
GO:2000810	Process	Regulation of bicellular tight junction assembly	IMP	15314165
GO:2000811	Process	Negative regulation of anoikis	IMP	17984306
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	ISS	10518215

MIM	HGNC	e!Ensembl
602150	11094	ENSG00000019549

O43623

Protein name

Zinc finger protein SNAI2 (Neural crest transcription factor Slug) (Protein snail homolog 2)

Protein function

Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occlu

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	128 → 150	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	159 → 181	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	185 → 207	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	213 → 235	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	241 → 262	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Ex

Sequence

MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH

Sequence length

268

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Piebaldism	Uncertain significance; Likely benign; Benign	rs577991090, rs529175130, rs751125107, rs186986959, rs566724701, rs11544359, rs576060545, rs886062983, rs886062984, rs371076039, rs886062985, rs78830147, rs886062986, rs886062987, rs370952195 View all (17 more)	RCV000261701 RCV000376303 RCV000267513 RCV000350118 RCV000381949 RCV000385458 RCV000293671 RCV000400858 RCV000260378 RCV000381494 RCV000289352 RCV000356452 RCV000299485 RCV000303169 RCV000397450 RCV000314839 RCV000356920 RCV001161495 RCV001164991 RCV001164992 RCV001160079 RCV001160080 RCV001160081 RCV001160082 RCV001160083 RCV001161493 RCV001161494 RCV001161496 RCV001163015 RCV001163016 RCV001165102 RCV001165103
SNAI2-related disorder	Likely benign; Benign; Uncertain significance	rs376110241, rs746846227, rs370952195, rs201920149, rs555086214, rs181954619	RCV003903383 RCV003898538 RCV004757223 RCV003912557 RCV003938192 RCV003930475

Show/Hide Text Mining Associations (171)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	38016947
Adenocarcinoma	Associate	18286686, 25120788, 27191723
Adenocarcinoma Mucinous	Associate	32840168
Adenocarcinoma of Lung	Associate	25120788, 27486982, 30321617, 31970942, 33021972, 36071042
Adenoma Pleomorphic	Associate	35145202
Adenomyosis	Stimulate	26307032
Alveolar Bone Loss	Associate	34663464
Alzheimer Disease	Stimulate	38016947
Anophthalmia with pulmonary hypoplasia	Associate	37832352
Arthritis Rheumatoid	Associate	20418652
Ascites	Associate	34363722
Astrocytoma	Associate	26654598
Atherosclerosis	Associate	34329656
Atrial Fibrillation	Associate	35607269
Bone Diseases	Associate	20863401
Brain Neoplasms	Associate	23157797
Breast Neoplasms	Associate	15737616, 15742334, 16773075, 18485278, 19604397, 20010940, 20509143, 21044962, 22028892, 22151997, 22496452, 23011797, 23031797, 23721519, 24036252 View all (27 more)
Breast Neoplasms	Stimulate	31681835
Calcinosis Cutis	Associate	30189837, 35806108, 36920782
Cap Myopathy	Associate	23475579
Carcinogenesis	Associate	29397868
Carcinoma	Stimulate	32661742
Carcinoma Adenoid Cystic	Associate	25885343, 26349748, 27181103, 27540976, 28946551
Carcinoma Basal Cell	Associate	20509143, 24870796
Carcinoma Ductal	Associate	19751508, 25645984
Carcinoma Hepatocellular	Associate	27102441, 31685543, 32901858, 34338154, 35345355, 37138218, 37596321
Carcinoma Large Cell	Inhibit	25413006
Carcinoma Non Small Cell Lung	Associate	24662916, 25928859, 28705116, 30070323, 30612578, 31661137, 34445544, 35740931, 36276640
Carcinoma Ovarian Epithelial	Associate	28097141, 32681294, 36375842
Carcinoma Pancreatic Ductal	Associate	18766116, 30791220
Carcinoma Renal Cell	Inhibit	21808237
Carcinoma Renal Cell	Associate	22363672, 26036633, 26261509, 27297979, 31658319, 36536414, 36766694
Carcinoma Renal Cell	Stimulate	24112779, 32124963
Carcinoma Small Cell	Stimulate	25413006
Carcinoma Squamous Cell	Associate	20150431, 24870796, 27081041, 28338201, 31886179, 32784485, 35763651
Carcinoma Squamous Cell	Stimulate	27138192
Carcinosarcoma	Associate	19389926
Cerebral Amyloid Angiopathy	Associate	38016947
Cholangiocarcinoma	Associate	20503457, 24280681, 24816558, 37369494
Chordoma	Associate	24760686
Cicatrix Hypertrophic	Associate	23226515
Colorectal Neoplasms	Associate	16773075, 19502595, 20138990, 20562906, 23996472, 25249558, 25750173, 25846868, 26379394, 27315462, 29202800, 29504907, 30531836, 30917533, 32107843 View all (8 more)
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	29309923
Conotruncal cardiac defects	Associate	24127225
Crohn Disease	Associate	27113480
Cysts	Associate	36149218
Death	Stimulate	33457409
Death	Associate	33605548
Desmoplastic Small Round Cell Tumor	Associate	28415643
Diabetic Foot	Associate	33053534
Disease	Associate	27287534
Drug Related Side Effects and Adverse Reactions	Associate	25733818
Ductus Arteriosus Patent	Associate	18766116
Dyskinesias	Associate	21785273
Ehlers Danlos Syndrome	Associate	29309923
Ehlers Danlos syndrome type 3	Associate	29309923
Endometrial Neoplasms	Associate	23114646, 26868332, 27449470, 29080395, 37169340
Endometrial Neoplasms	Stimulate	26367784, 33457409
Endometrial Stromal Tumors	Associate	32982173
Endometriosis	Associate	26198055, 35616875
Endometritis	Stimulate	33826645
Epidermolysis bullosa with pyloric atresia	Stimulate	35145202
Esophageal Neoplasms	Associate	25322669, 34160902
Esophageal Squamous Cell Carcinoma	Associate	16773075, 24367561, 26370982, 31324391
Esophagitis	Associate	24367561
Fibrosis	Associate	26327314, 27113480, 36149218
Fistula	Associate	24284372
Gallbladder Neoplasms	Associate	34913073
Gastrointestinal Stromal Tumors	Associate	28334729, 33603171
Gingival Overgrowth	Stimulate	27287534
Glioblastoma	Associate	22493711, 23482671, 25871397, 26654598, 28351300, 32705169
Glioma	Associate	20646316, 37408388, 40604866
Gliosarcoma	Associate	22288519
Glycogen Storage Disease Type IV	Stimulate	33457409
Head and Neck Neoplasms	Associate	34382739, 34768995
Hemangioma	Associate	28710904
Hemangiopericytoma	Stimulate	23029385
Heredodegenerative Disorders Nervous System	Associate	36553576
Hypoxia	Stimulate	20010940, 23050024, 24112779, 25096400, 26379394, 30058095, 30612578, 38016947
Hypoxia	Associate	29592811
Hypoxia Brain	Associate	24036252
Immunoglobulin G4 Related Disease	Associate	37882064
Inflammation	Associate	25120788, 29794474, 35848968, 38065913
Inflammation	Stimulate	25846868, 27287534
Inflammatory Bowel Diseases	Associate	27113480
Intestinal Diseases	Associate	34510400
Keratosis Actinic	Associate	31299087
Kidney Neoplasms	Associate	37569620
Klatskin Tumor	Associate	20594328
Laryngeal Neoplasms	Associate	25491625
Leiomyosarcoma	Associate	20651304
Leukemia	Associate	25555870
Lung Diseases	Associate	25337226, 25413006
Lung Neoplasms	Associate	22933707, 23244088, 25120788, 26387547, 28350337, 28487957, 30251328, 30612578, 31271097, 31941995, 32753472, 33744858, 35740931, 36553576
Lymphatic Diseases	Stimulate	33761659
Lymphatic Metastasis	Stimulate	20503457, 24427353, 28974196, 29794474, 33761659, 38522060
Lymphatic Metastasis	Associate	21647877, 23157797, 25645984, 28487957, 33799604, 33817718
Lymphatic Metastasis	Inhibit	25686823
Lymphoma T Cell Peripheral	Associate	32567520
Malignant mesenchymal tumor	Associate	16521229, 22288519, 32503225
Melanoma	Associate	17641412, 21593765, 22503751, 22911700, 31171904, 33154524, 36866769
Meningeal Carcinomatosis	Associate	30451796
Meningeal Neoplasms	Associate	23029385
Mesothelioma Malignant	Associate	15337769, 23886156
Metaplasia	Associate	18385519
Mitochondrial Diseases	Stimulate	35918485
Mouth Diseases	Associate	34144151
Mouth Neoplasms	Associate	28574664, 29969465
Multiple Myeloma	Associate	28008160, 34738621
Nasal Polyps	Associate	28615628
Nasopharyngeal Carcinoma	Associate	26934447, 28338201, 31907338, 37563118
Necrosis	Associate	38065913
Neoplasm Invasiveness	Stimulate	33457409
Neoplasm Metastasis	Associate	16773075, 17318900, 20594328, 21044962, 21647815, 21647877, 22028892, 22151997, 22496452, 22791812, 22911700, 23150175, 23244088, 25053741, 25686823 View all (22 more)
Neoplasm Metastasis	Inhibit	17984306, 24059685
Neoplasm Metastasis	Stimulate	23577117, 25409617, 33457409, 38522060
Neoplasms	Associate	17318900, 17855508, 17984306, 20150431, 20506051, 20562906, 20594328, 20809941, 22074556, 23029385, 23114646, 23150175, 23677615, 23799116, 24497324 View all (47 more)
Neoplasms	Stimulate	19820419, 21809991, 22201613, 28380418, 29969465, 34090218, 38113139
Neoplasms	Inhibit	21808237, 31987042, 33918086
Neoplasms Germ Cell and Embryonal	Associate	20178649, 32441446
Neoplasms Squamous Cell	Associate	29739791, 38087142
Neuroendocrine Tumors	Associate	37033229
Non Muscle Invasive Bladder Neoplasms	Associate	40340993
Obesity	Stimulate	22355352
Odontogenic Tumors	Associate	25879017
Osteoarthritis	Associate	25797039
Ovarian Neoplasms	Associate	15742334, 18550773, 22232246, 22429801, 22479527, 23554977, 25944620, 27129169, 27166196, 30628686, 31165775, 33478150, 34363722, 38527595
Pancreatic Carcinoma	Associate	30451796
Pancreatic Neoplasms	Associate	19820419, 21678462, 21909380, 22232555, 25409617, 25860483, 36932397, 37251370
Pancreatitis Chronic	Associate	18766116
Papillomavirus Infections	Associate	23778524
Pelvic Inflammatory Disease	Stimulate	33457409
Pelvic Organ Prolapse	Associate	27818488
Penile Neoplasms	Associate	35806108
Personality Disorders	Associate	25750173, 31658319
Phyllodes Tumor	Associate	23150175
Piebaldism	Associate	37357653
Precancerous Conditions	Associate	37175770
Prodromal Symptoms	Stimulate	24427353
Prostatic Neoplasms	Associate	20506051, 22074556, 26540632, 26983806, 27356744, 29206234, 29300772, 30058095, 30754655, 31060254, 31636385, 33174391, 33605548, 33799604, 34322653 View all (4 more)
Prostatic Neoplasms	Inhibit	25686823
Prostatic Neoplasms	Stimulate	30065348, 32124938
Prostatitis	Associate	36232736, 38065913
Rhabdomyosarcoma	Associate	34285060, 37882064
Sarcoma	Associate	21983934
Sarcoma Synovial	Associate	21809991, 33076385
Scleroderma Systemic	Associate	26360820
Seminoma	Associate	32441446
Skin Neoplasms	Stimulate	31299087
Skin Neoplasms	Associate	35263398
Small Cell Lung Carcinoma	Associate	26387547
Solitary Fibrous Tumors	Stimulate	23029385
Spherocytosis Type 1	Associate	37922232
Squamous Cell Carcinoma of Head and Neck	Associate	21304586, 21647877, 21785273, 22201613, 25762643, 26214683, 26861993, 28574664, 29739791, 29794474, 29969465, 30261040, 31439759, 31861233, 31938073 View all (5 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	35219646
Stomach Neoplasms	Associate	16521229, 28829503, 28974196, 29336198, 30198421, 32329839, 33095806, 34135208, 36457025, 36580668, 36768307
Tachycardia Atrioventricular Nodal Reentry	Associate	20809941
Tarlov Cysts	Associate	26349748
Thyroid Cancer Papillary	Associate	24427353, 27845909
Thyroid Carcinoma Anaplastic	Associate	22899291, 25755746, 28128736
Thyroid Neoplasms	Associate	22641097, 22899291, 31228933, 39179334
Triple Negative Breast Neoplasms	Associate	22496452, 25982283, 37342906
Tuberculosis Multidrug Resistant	Associate	25635866, 28334049
Urethral Neoplasms	Associate	35763651, 40340993
Urinary Bladder Neoplasms	Associate	20809941, 29250666, 29517839, 35763651
Uterine Cervical Dysplasia	Associate	30791220, 37832352
Uterine Cervical Dysplasia	Stimulate	37175770
Uterine Cervical Neoplasms	Associate	23226515, 32899940, 36674577, 37175770
Varicose Veins	Associate	34944071
Waardenburg Syndrome	Associate	25932447, 26781036, 29630160, 30936914, 32908492, 36329483
Waardenburg syndrome type 2A	Associate	17999358

SNAI2 (snail family transcriptional repressor 2)