Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	64750
Gene name	SMAD specific E3 ubiquitin protein ligase 2
Gene symbol	SMURF2
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q23.3-q24.1

194

Show/Hide all (194)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023400	hsa-miR-122-5p	Microarray	17612493
MIRT031987	hsa-miR-16-5p	Microarray	21199864
MIRT653292	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT653291	hsa-miR-764	HITS-CLIP	23824327
MIRT653290	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT653289	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT653288	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT653287	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT653286	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT653285	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT653284	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT653283	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT653282	hsa-miR-4454	HITS-CLIP	23824327
MIRT653281	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT542376	hsa-miR-6872-3p	PAR-CLIP	21572407
MIRT542375	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT534142	hsa-miR-3667-5p	PAR-CLIP	22012620
MIRT534141	hsa-miR-4495	PAR-CLIP	22012620
MIRT534140	hsa-miR-665	PAR-CLIP	22012620
MIRT534139	hsa-miR-4635	PAR-CLIP	22012620
MIRT197869	hsa-miR-630	PAR-CLIP	22012620
MIRT534138	hsa-miR-526b-5p	PAR-CLIP	22012620
MIRT450665	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT450664	hsa-miR-382-5p	PAR-CLIP	22100165
MIRT450663	hsa-miR-93-3p	PAR-CLIP	22100165
MIRT450662	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT450661	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT450660	hsa-miR-511-5p	PAR-CLIP	22100165
MIRT733577	hsa-miR-497-5p	Flow cytometryLuciferase reporter assayqRT-PCRWestern blotting	33193708
MIRT733577	hsa-miR-497-5p	Flow cytometryLuciferase reporter assayqRT-PCRWestern blotting	33193708
MIRT736113	hsa-miR-503-5p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometryELISA	33872218
MIRT653292	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT653291	hsa-miR-764	HITS-CLIP	23824327
MIRT653290	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT653289	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT653288	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT653287	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT653286	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT653285	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT653284	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT653283	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT653282	hsa-miR-4454	HITS-CLIP	23824327
MIRT653281	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT542376	hsa-miR-6872-3p	PAR-CLIP	21572407
MIRT542375	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT534142	hsa-miR-3667-5p	PAR-CLIP	22012620
MIRT534141	hsa-miR-4495	PAR-CLIP	22012620
MIRT534140	hsa-miR-665	PAR-CLIP	22012620
MIRT534139	hsa-miR-4635	PAR-CLIP	22012620
MIRT197869	hsa-miR-630	PAR-CLIP	22012620
MIRT534138	hsa-miR-526b-5p	PAR-CLIP	22012620
MIRT450665	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT450664	hsa-miR-382-5p	PAR-CLIP	22100165
MIRT450663	hsa-miR-93-3p	PAR-CLIP	22100165
MIRT450662	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT450661	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT450660	hsa-miR-511-5p	PAR-CLIP	22100165
MIRT1374472	hsa-miR-1179	CLIP-seq
MIRT1374473	hsa-miR-15a	CLIP-seq
MIRT1374474	hsa-miR-15b	CLIP-seq
MIRT1374475	hsa-miR-16	CLIP-seq
MIRT1374476	hsa-miR-195	CLIP-seq
MIRT1374477	hsa-miR-299-5p	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT1374479	hsa-miR-3646	CLIP-seq
MIRT1374480	hsa-miR-3919	CLIP-seq
MIRT1374481	hsa-miR-424	CLIP-seq
MIRT1374482	hsa-miR-4310	CLIP-seq
MIRT1374483	hsa-miR-4464	CLIP-seq
MIRT1374484	hsa-miR-4477a	CLIP-seq
MIRT1374485	hsa-miR-4524	CLIP-seq
MIRT1374486	hsa-miR-4698	CLIP-seq
MIRT1374487	hsa-miR-4719	CLIP-seq
MIRT1374488	hsa-miR-4723-5p	CLIP-seq
MIRT1374489	hsa-miR-4748	CLIP-seq
MIRT1374490	hsa-miR-4756-3p	CLIP-seq
MIRT1374491	hsa-miR-497	CLIP-seq
MIRT1374492	hsa-miR-502-5p	CLIP-seq
MIRT1374493	hsa-miR-503	CLIP-seq
MIRT1374494	hsa-miR-607	CLIP-seq
MIRT1374495	hsa-miR-646	CLIP-seq
MIRT1374496	hsa-miR-659	CLIP-seq
MIRT1374497	hsa-miR-9	CLIP-seq
MIRT1374473	hsa-miR-15a	CLIP-seq
MIRT1374474	hsa-miR-15b	CLIP-seq
MIRT1374475	hsa-miR-16	CLIP-seq
MIRT1374476	hsa-miR-195	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT1374481	hsa-miR-424	CLIP-seq
MIRT1374484	hsa-miR-4477a	CLIP-seq
MIRT1374485	hsa-miR-4524	CLIP-seq
MIRT1553871	hsa-miR-4757-5p	CLIP-seq
MIRT1374491	hsa-miR-497	CLIP-seq
MIRT1374493	hsa-miR-503	CLIP-seq
MIRT1374495	hsa-miR-646	CLIP-seq
MIRT1553872	hsa-miR-663b	CLIP-seq
MIRT1553873	hsa-miR-676	CLIP-seq
MIRT1557071	hsa-miR-3185	CLIP-seq
MIRT1374472	hsa-miR-1179	CLIP-seq
MIRT2111443	hsa-miR-1206	CLIP-seq
MIRT2111444	hsa-miR-1208	CLIP-seq
MIRT1374473	hsa-miR-15a	CLIP-seq
MIRT1374474	hsa-miR-15b	CLIP-seq
MIRT1374475	hsa-miR-16	CLIP-seq
MIRT1374476	hsa-miR-195	CLIP-seq
MIRT1374477	hsa-miR-299-5p	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT2111445	hsa-miR-330-3p	CLIP-seq
MIRT2111446	hsa-miR-34b	CLIP-seq
MIRT1374480	hsa-miR-3919	CLIP-seq
MIRT1374481	hsa-miR-424	CLIP-seq
MIRT1374482	hsa-miR-4310	CLIP-seq
MIRT2111447	hsa-miR-4422	CLIP-seq
MIRT2111448	hsa-miR-4470	CLIP-seq
MIRT1374484	hsa-miR-4477a	CLIP-seq
MIRT2111449	hsa-miR-4496	CLIP-seq
MIRT1374485	hsa-miR-4524	CLIP-seq
MIRT1374490	hsa-miR-4756-3p	CLIP-seq
MIRT1553871	hsa-miR-4757-5p	CLIP-seq
MIRT2111450	hsa-miR-485-3p	CLIP-seq
MIRT1374491	hsa-miR-497	CLIP-seq
MIRT1374493	hsa-miR-503	CLIP-seq
MIRT1374495	hsa-miR-646	CLIP-seq
MIRT1374496	hsa-miR-659	CLIP-seq
MIRT1553872	hsa-miR-663b	CLIP-seq
MIRT1553873	hsa-miR-676	CLIP-seq
MIRT1374497	hsa-miR-9	CLIP-seq
MIRT1374472	hsa-miR-1179	CLIP-seq
MIRT2111443	hsa-miR-1206	CLIP-seq
MIRT2111444	hsa-miR-1208	CLIP-seq
MIRT2334578	hsa-miR-1244	CLIP-seq
MIRT2334579	hsa-miR-1299	CLIP-seq
MIRT2334580	hsa-miR-200b	CLIP-seq
MIRT2334581	hsa-miR-200c	CLIP-seq
MIRT2334582	hsa-miR-223	CLIP-seq
MIRT2334583	hsa-miR-296-3p	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT2334584	hsa-miR-3173-3p	CLIP-seq
MIRT2111446	hsa-miR-34b	CLIP-seq
MIRT2334585	hsa-miR-382	CLIP-seq
MIRT2334586	hsa-miR-4280	CLIP-seq
MIRT2334587	hsa-miR-429	CLIP-seq
MIRT1374482	hsa-miR-4310	CLIP-seq
MIRT1374484	hsa-miR-4477a	CLIP-seq
MIRT2111449	hsa-miR-4496	CLIP-seq
MIRT2334588	hsa-miR-4695-5p	CLIP-seq
MIRT2334589	hsa-miR-4697-3p	CLIP-seq
MIRT2334590	hsa-miR-4704-3p	CLIP-seq
MIRT2334591	hsa-miR-4738-3p	CLIP-seq
MIRT2334592	hsa-miR-4766-5p	CLIP-seq
MIRT2111450	hsa-miR-485-3p	CLIP-seq
MIRT2334593	hsa-miR-485-5p	CLIP-seq
MIRT2334594	hsa-miR-488	CLIP-seq
MIRT2334595	hsa-miR-514	CLIP-seq
MIRT2334596	hsa-miR-514b-3p	CLIP-seq
MIRT2334597	hsa-miR-549	CLIP-seq
MIRT2334598	hsa-miR-568	CLIP-seq
MIRT2334599	hsa-miR-595	CLIP-seq
MIRT2334600	hsa-miR-618	CLIP-seq
MIRT1553873	hsa-miR-676	CLIP-seq
MIRT2334601	hsa-miR-875-3p	CLIP-seq
MIRT2394895	hsa-miR-128	CLIP-seq
MIRT2394896	hsa-miR-2355-3p	CLIP-seq
MIRT2394897	hsa-miR-27a	CLIP-seq
MIRT2394898	hsa-miR-27b	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT1374479	hsa-miR-3646	CLIP-seq
MIRT2394899	hsa-miR-3662	CLIP-seq
MIRT2394900	hsa-miR-3679-3p	CLIP-seq
MIRT1374486	hsa-miR-4698	CLIP-seq
MIRT1374487	hsa-miR-4719	CLIP-seq
MIRT1553873	hsa-miR-676	CLIP-seq
MIRT2433338	hsa-miR-203	CLIP-seq
MIRT2334582	hsa-miR-223	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT2334584	hsa-miR-3173-3p	CLIP-seq
MIRT2334588	hsa-miR-4695-5p	CLIP-seq
MIRT2334589	hsa-miR-4697-3p	CLIP-seq
MIRT2334591	hsa-miR-4738-3p	CLIP-seq
MIRT2334592	hsa-miR-4766-5p	CLIP-seq
MIRT2334593	hsa-miR-485-5p	CLIP-seq
MIRT2334594	hsa-miR-488	CLIP-seq
MIRT2628595	hsa-miR-1253	CLIP-seq
MIRT2628596	hsa-miR-3163	CLIP-seq
MIRT2628597	hsa-miR-3194-3p	CLIP-seq
MIRT2628598	hsa-miR-3921	CLIP-seq
MIRT2628599	hsa-miR-4251	CLIP-seq
MIRT2628600	hsa-miR-4329	CLIP-seq
MIRT2628601	hsa-miR-4653-5p	CLIP-seq
MIRT2628602	hsa-miR-4668-3p	CLIP-seq
MIRT2628603	hsa-miR-545	CLIP-seq
MIRT2628604	hsa-miR-548c-3p	CLIP-seq
MIRT2628605	hsa-miR-548p	CLIP-seq
MIRT2628606	hsa-miR-605	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000151	Component	Ubiquitin ligase complex	IDA	14755250
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	14755250
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005515	Function	Protein binding	IPI	14755250, 15231748, 17719543, 18729074, 18985028, 20676133, 20937913, 21572392, 22045334, 22070932, 22921829, 25438670, 28514442, 30696809, 32296183, 33673144, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	11163210
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	14755250
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	NAS	11158580
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	19255252
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	21791611
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0030514	Process	Negative regulation of BMP signaling pathway	IBA
GO:0030514	Process	Negative regulation of BMP signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IPI	15231748, 17719543
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0045121	Component	Membrane raft	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	11016919
GO:0046332	Function	SMAD binding	IBA
GO:0046332	Function	SMAD binding	IEA
GO:0046332	Function	SMAD binding	IPI	19122240
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	19122240
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901165	Process	Positive regulation of trophoblast cell migration	IDA	19255252

MIM	HGNC	e!Ensembl
605532	16809	ENSG00000108854

Q9HAU4

Protein name

E3 ubiquitin-protein ligase SMURF2 (hSMURF2) (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase SMURF2) (SMAD ubiquitination regulatory factor 2) (SMAD-specific E3 ubiquitin-protein ligase 2)

Protein function

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:11016919). Interacts with SMAD7 to trigger SMAD7-medi

PDB

1ZVD , 2DJY , 2JQZ , 2KXQ , 2LTZ , 6FX4 , 7M3Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	12 → 114	C2 domain	Domain
PF00397	WW	159 → 188	WW domain	Domain
PF00397	WW	253 → 282	WW domain	Domain
PF00397	WW	299 → 328	WW domain	Domain
PF00632	HECT	443 → 748	HECT-domain (ubiquitin-transferase)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDT
ECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHL
SYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILEND
ITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLA
LQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAV
EFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRI
DIPPYESYEKLYEKLLTAIEETCGFAVE

Sequence length

748

Interactions

View interactions

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs80215473	RCV005933535
Cervical cancer	Benign	rs80215473	RCV005933539
Clear cell carcinoma of kidney	Benign	rs80215473	RCV005933540
Colon adenocarcinoma	Benign	rs80215473	RCV005933534
Colorectal cancer	Benign	rs80215473	RCV005933541
Hepatocellular carcinoma	Benign	rs80215473	RCV005933536
Malignant tumor of esophagus	Benign	rs80215473	RCV005933537
Melanoma	Benign	rs80215473	RCV005933543
Nonpapillary renal cell carcinoma	Benign	rs80215473	RCV005933538
Sarcoma	Benign	rs80215473	RCV005933542
SMURF2-related disorder	Likely benign; Benign	rs528473359, rs75656954, rs374025782, rs373915337, rs144568802, rs80215473, rs147881898, rs544040158, rs536814155, rs147790846, rs370631579, rs200706492, rs34788315, rs143629300	RCV003896817 RCV003919671 RCV003899204 RCV003933959 RCV003943976 RCV003972075 RCV003961418 RCV003939355 RCV003934434 RCV003926803 RCV003937392 RCV003969089 RCV003926064 RCV003910756
Uterine corpus endometrial carcinoma	Benign	rs80215473	RCV005933544

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Aging Premature	Associate	29405587
Aortic Valve Calcification of	Associate	28377507
Asthma	Associate	34749662
Breast Neoplasms	Associate	18927080, 19155312, 27136586, 28423498, 29534682
Breast Neoplasms	Inhibit	24485087
Carcinogenesis	Associate	37828084
Carcinoma Ductal	Inhibit	24485087
Carcinoma Intraductal Noninfiltrating	Associate	24485087
Carcinoma Non Small Cell Lung	Associate	35710591
Cardiomyopathy Dilated	Associate	25137373
Cicatrix Hypertrophic	Associate	21920670
Colorectal Neoplasms	Associate	23922913, 35361871
Fibrosis	Associate	21920670
Inflammation	Associate	33849596
Liver Cirrhosis	Associate	21920670
Liver Neoplasms	Associate	35361871
Lung Diseases	Associate	21967197
Neoplasm Metastasis	Inhibit	18927080
Neoplasm Metastasis	Stimulate	19155312
Neoplasm Metastasis	Associate	35361871
Neoplasms	Inhibit	24485087, 35361871
Neoplasms	Associate	29405587, 34202736, 39208653
Osteoarthritis	Associate	33090007, 33849596
Osteoporosis	Associate	29405587
Ovarian Neoplasms	Associate	37828084
Pancreatic Neoplasms	Associate	35637952
Progeria	Associate	29405587
Smoke Inhalation Injury	Associate	35637952
Triple Negative Breast Neoplasms	Inhibit	24485087
Uterine Cervical Neoplasms	Associate	34202736

SMURF2 (SMAD specific E3 ubiquitin protein ligase 2)