Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4088
Gene name Gene Name - the full gene name approved by the HGNC.	SMAD family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SMAD3
Synonyms (NCBI Gene) Gene synonyms aliases	HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3, hMAD-3, hSMAD3, mad3
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q22.33
Summary Summary of gene provided in NCBI Entrez Gene.	The SMAD family of proteins are a group of intracellular signal transducer proteins similar to the gene products of the Drosophila gene `mothers against decapentaplegic` (Mad) and the C. elegans gene Sma. The SMAD3 protein functions in the transforming gr

Show/Hide all(77)

SNP ID	Visualize variation	Clinical significance	Consequence
rs139616052	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, synonymous variant
rs201263330	G>C,T	Likely-pathogenic	Coding sequence variant, missense variant
rs201912204	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance, benign	Upstream transcript variant, intron variant, genic upstream transcript variant
rs202094530	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs387906850	C>T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs387906851	C>T	Pathogenic	Coding sequence variant, missense variant
rs387906852	G>A	Pathogenic	Coding sequence variant, missense variant
rs387906853	G>A,T	Risk-factor, likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant, stop gained
rs387906854	C>T	Uncertain-significance, pathogenic	Coding sequence variant, upstream transcript variant, genic upstream transcript variant, missense variant
rs387906855	C>G,T	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs387906856	G>A,C,T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant, stop gained
rs587776880	AT>-	Pathogenic	Frameshift variant, coding sequence variant
rs587776881	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs587776882	G>-	Pathogenic, not-provided	Frameshift variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs587782977	G>A	Uncertain-significance, likely-pathogenic	Genic upstream transcript variant, coding sequence variant, missense variant, upstream transcript variant
rs730880214	G>A	Pathogenic, uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs730880215	G>A,T	Pathogenic, likely-pathogenic	Stop gained, coding sequence variant, missense variant
rs745672741	G>A,C	Pathogenic	Genic upstream transcript variant, intron variant, upstream transcript variant
rs753486471	C>A,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs753875974	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs757106110	C>A,T	Pathogenic, likely-benign	Stop gained, synonymous variant, coding sequence variant
rs768713596	C>T	Pathogenic, likely-pathogenic	5 prime UTR variant, upstream transcript variant, stop gained, genic upstream transcript variant, coding sequence variant
rs770098673	G>C,T	Likely-pathogenic	Splice donor variant, genic upstream transcript variant
rs776577220	G>A	Conflicting-interpretations-of-pathogenicity	Intron variant
rs794727798	C>T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs863223737	G>A,C	Uncertain-significance, likely-pathogenic, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs863223738	G>C	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs863223740	G>A	Uncertain-significance, pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs863223741	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223750	G>T	Pathogenic	Coding sequence variant, genic upstream transcript variant, stop gained
rs863223754	->C	Pathogenic	Frameshift variant, coding sequence variant
rs863223757	AG>-	Likely-pathogenic	Frameshift variant, upstream transcript variant, genic upstream transcript variant, coding sequence variant
rs863223759	C>-	Pathogenic	Intron variant, upstream transcript variant, coding sequence variant, frameshift variant, genic upstream transcript variant
rs863223761	T>C	Likely-pathogenic	Splice donor variant
rs863223762	G>T	Pathogenic	Coding sequence variant, genic upstream transcript variant, stop gained
rs863223768	T>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs863223770	->A	Pathogenic	Upstream transcript variant, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant, stop gained
rs863223771	C>-	Pathogenic	Intron variant, upstream transcript variant, coding sequence variant, frameshift variant, genic upstream transcript variant
rs886038770	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs886038836	A>G	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs886039177	A>G	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs958007552	C>A	Conflicting-interpretations-of-pathogenicity	Genic upstream transcript variant, intron variant, 5 prime UTR variant
rs1057518977	G>T	Likely-pathogenic	Genic upstream transcript variant, 5 prime UTR variant, missense variant, upstream transcript variant, coding sequence variant
rs1060500770	G>-,GGG	Pathogenic	Coding sequence variant, frameshift variant
rs1060500771	G>T	Likely-pathogenic	Splice donor variant
rs1060500773	CACAC>-	Pathogenic	Intron variant, frameshift variant, genic upstream transcript variant, upstream transcript variant, coding sequence variant
rs1064794789	G>-	Likely-pathogenic	Genic upstream transcript variant, stop gained, coding sequence variant
rs1320208623	G>A,T	Likely-pathogenic	Missense variant, coding sequence variant
rs1555405108	G>-	Pathogenic	Frameshift variant, coding sequence variant, genic upstream transcript variant
rs1555412069	->G	Pathogenic	Upstream transcript variant, coding sequence variant, frameshift variant, 5 prime UTR variant, genic upstream transcript variant
rs1555412070	->GC	Pathogenic	Upstream transcript variant, coding sequence variant, frameshift variant, 5 prime UTR variant, genic upstream transcript variant
rs1555412294	C>-	Pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant
rs1555412629	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555413562	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555414236	->TGTCTACCAGTTG	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555414495	TCCTCACCCAGATGGG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555414503	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1566991387	G>A	Likely-pathogenic	5 prime UTR variant, genic upstream transcript variant, missense variant, coding sequence variant, upstream transcript variant
rs1566999423	->GACA	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1566999458	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1566999601	T>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1566999610	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1566999621	AGCTGACACGGAGA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1567002059	TAACCAGCGCTAT>GACACC	Pathogenic	Coding sequence variant, frameshift variant
rs1567002115	G>T	Pathogenic	Coding sequence variant, stop gained
rs1595941653	->GCC	Pathogenic	5 prime UTR variant, genic upstream transcript variant, coding sequence variant, inframe insertion, upstream transcript variant
rs1595941823	GC>CT	Likely-pathogenic	Coding sequence variant, upstream transcript variant, missense variant, genic upstream transcript variant
rs1595941909	C>-	Likely-pathogenic	Coding sequence variant, upstream transcript variant, frameshift variant, genic upstream transcript variant
rs1595942351	C>-	Pathogenic	Genic upstream transcript variant, intron variant, coding sequence variant, frameshift variant, upstream transcript variant
rs1595956416	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1595956538	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1595956573	->CAGTCATGGATGGCTGCGAGGCGTGGAATGTCTCCCCGACGCGCAGCCATCCA	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1595956832	G>A	Pathogenic	Splice donor variant
rs1595960347	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1595960447	C>T	Pathogenic	Coding sequence variant, stop gained
rs1595962708	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1595965925	TG>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(621)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007291	hsa-miR-200a-3p	Luciferase reporter assay	22020340
MIRT007291	hsa-miR-200a-3p	Luciferase reporter assay	22020340
MIRT007323	hsa-miR-18a-5p	Western blot	23249750
MIRT018567	hsa-miR-335-5p	Microarray	18185580
MIRT020918	hsa-miR-155-5p	Western blot	21036908
MIRT050933	hsa-miR-17-5p	CLASH	23622248
MIRT041360	hsa-miR-193b-3p	CLASH	23622248
MIRT053644	hsa-miR-143-3p	Microarray	22942087
MIRT053650	hsa-miR-145-5p	Microarray	22942087
MIRT041360	hsa-miR-193b-3p	Luciferase reporter assay, qRT-PCR, Western blot	24496888
MIRT053650	hsa-miR-145-5p	Luciferase reporter assay, Western blot, qRT-PCR, ELISA, Immunofluorescence	24873879
MIRT053650	hsa-miR-145-5p	Luciferase reporter assay	23632450
MIRT053650	hsa-miR-145-5p	Luciferase reporter assay	23632450
MIRT438641	hsa-miR-92b-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23892108
MIRT438641	hsa-miR-92b-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23892108
MIRT438275	hsa-miR-491-5p	Luciferase reporter assay, qRT-PCR, Western blot	25196641
MIRT438244	gga-miR-489-3p	Luciferase reporter assay	24786471
MIRT438641	hsa-miR-92b-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23892108
MIRT438641	hsa-miR-92b-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23892108
MIRT438275	hsa-miR-491-5p	Luciferase reporter assay, qRT-PCR, Western blot	25196641
MIRT438244	gga-miR-489-3p	Luciferase reporter assay	24786471
MIRT072699	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT497692	hsa-miR-18a-3p	PAR-CLIP	22291592
MIRT497691	hsa-miR-4290	PAR-CLIP	22291592
MIRT140820	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT140825	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT140821	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT140827	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT731257	hsa-miR-323a-3p	CFPAC-1	26908446
MIRT731257	hsa-miR-323a-3p	CFPAC-1	26908446
MIRT140830	hsa-miR-497-5p	qRT-PCR	27063509
MIRT140830	hsa-miR-497-5p	qRT-PCR	27063509
MIRT731442	hsa-miR-708-5p	Luciferase reporter assay	26932538
MIRT731442	hsa-miR-708-5p	Luciferase reporter assay	26932538
MIRT731517	hsa-miR-199a-5p	Luciferase reporter assay	27038547
MIRT731517	hsa-miR-199a-5p	Luciferase reporter assay	27038547
MIRT731257	hsa-miR-323a-3p	Luciferase reporter assay	26908446
MIRT731257	hsa-miR-323a-3p	Luciferase reporter assay	26908446
MIRT193928	hsa-miR-142-5p	Luciferase reporter assay, qRT-PCR, Western blot	27683030
MIRT193928	hsa-miR-142-5p	Luciferase reporter assay, qRT-PCR, Western blot	27683030
MIRT193928	hsa-miR-142-5p	Luciferase reporter assay, qRT-PCR, Western blot	27683030
MIRT193928	hsa-miR-142-5p	Luciferase reporter assay, qRT-PCR, Western blot	27683030
MIRT193928	hsa-miR-142-5p	Luciferase reporter assay, qRT-PCR, Western blot	26572508
MIRT193928	hsa-miR-142-5p	Luciferase reporter assay, qRT-PCR, Western blot	26572508
MIRT732404	hsa-miR-145-3p	ELISA, Luciferase reporter assay, qRT-PCR	25704091
MIRT732404	hsa-miR-145-3p	ELISA, Luciferase reporter assay, qRT-PCR	25704091
MIRT731257	hsa-miR-323a-3p	qRT-PCR	27059796
MIRT732672	hsa-miR-32-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33758603
MIRT733468	hsa-miR-665	Luciferase reporter assay, qRT-PCR, Western blotting	34196584
MIRT733506	hsa-miR-371a-5p	qRT-PCR	34150008
MIRT733509	hsa-miR-410-3p	qRT-PCR	34150008
MIRT733549	hsa-miR-486-3p	Immunofluorescence, Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34080770
MIRT733641	hsa-miR-501-5p	Microarray, qRT-PCR, Western blotting	33968296
MIRT734020	hsa-miR-411-5p	Flow cytometry, Luciferase reporter assay, qRT-PCR, Western blotting	34169675
MIRT734020	hsa-miR-411-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	34169675
MIRT734617	hsa-miR-7641	Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32823722
MIRT734890	hsa-miR-497-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	33363213
MIRT734891	hsa-miR-195-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	33363213
MIRT735295	hsa-miR-192-3p	Immunohistochemistry (IHC), In situ hybridization	32420596
MIRT735826	hsa-miR-216b-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	32668597
MIRT735910	hsa-miR-346	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, In situ hybridization	33520980
MIRT732404	hsa-miR-145-3p	Luciferase reporter assay	33637048
MIRT053650	hsa-miR-145-5p	Luciferase reporter assay, Western blotting	33637048
MIRT736625	hsa-miR-1255b-5p	Western blotting, Immunohistochemistry (IHC), qRT-PCR	32679610
MIRT050933	hsa-miR-17-5p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization	31558704
MIRT737493	hsa-miR-29b-3p	Western blotting, Immunohistochemistry (IHC), ELISA	33763150
MIRT737551	hsa-miR-27a-3p	Western blotting, Microarray	31452017
MIRT737567	hsa-miR-182-3p	Luciferase reporter assay, qRT-PCR	32067333
MIRT739142	hsa-miR-4253	HITS-CLIP	33718276
MIRT739145	hsa-miR-1285	HITS-CLIP	33718276
MIRT739146	hsa-miR-612	HITS-CLIP	33718276
MIRT739147	hsa-miR-4487	HITS-CLIP	33718276
MIRT739148	hsa-miR-4756-3p	HITS-CLIP	33718276
MIRT739142	hsa-miR-4253	HITS-CLIP	33718276
MIRT739145	hsa-miR-1285	HITS-CLIP	33718276
MIRT072699	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT497692	hsa-miR-18a-3p	PAR-CLIP	22291592
MIRT497691	hsa-miR-4290	PAR-CLIP	22291592
MIRT193928	hsa-miR-142-5p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization, RNA pull down assay	34486400
MIRT734020	hsa-miR-411-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34169675
MIRT756400	hsa-miR-122-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36982775
MIRT1370627	hsa-miR-1291	CLIP-seq
MIRT1370628	hsa-miR-3125	CLIP-seq
MIRT1370629	hsa-miR-3184	CLIP-seq
MIRT1370630	hsa-miR-328	CLIP-seq
MIRT1370631	hsa-miR-3916	CLIP-seq
MIRT1370632	hsa-miR-423-5p	CLIP-seq
MIRT1370633	hsa-miR-4257	CLIP-seq
MIRT1370634	hsa-miR-4330	CLIP-seq
MIRT1370635	hsa-miR-105	CLIP-seq
MIRT1370636	hsa-miR-1197	CLIP-seq
MIRT1370637	hsa-miR-1202	CLIP-seq
MIRT1370638	hsa-miR-1206	CLIP-seq
MIRT1370639	hsa-miR-1207-5p	CLIP-seq
MIRT1370640	hsa-miR-1227	CLIP-seq
MIRT1370641	hsa-miR-1261	CLIP-seq
MIRT1370642	hsa-miR-1271	CLIP-seq
MIRT1370643	hsa-miR-1273f	CLIP-seq
MIRT1370644	hsa-miR-1284	CLIP-seq
MIRT1370645	hsa-miR-1290	CLIP-seq
MIRT1370627	hsa-miR-1291	CLIP-seq
MIRT1370646	hsa-miR-1305	CLIP-seq
MIRT1370647	hsa-miR-145	CLIP-seq
MIRT1370648	hsa-miR-146a	CLIP-seq
MIRT1370649	hsa-miR-146b-5p	CLIP-seq
MIRT1370650	hsa-miR-1470	CLIP-seq
MIRT1370651	hsa-miR-153	CLIP-seq
MIRT1370652	hsa-miR-15a	CLIP-seq
MIRT1370653	hsa-miR-15b	CLIP-seq
MIRT1370654	hsa-miR-16	CLIP-seq
MIRT1370655	hsa-miR-181a	CLIP-seq
MIRT1370656	hsa-miR-181b	CLIP-seq
MIRT1370657	hsa-miR-181c	CLIP-seq
MIRT1370658	hsa-miR-181d	CLIP-seq
MIRT1370659	hsa-miR-182	CLIP-seq
MIRT1370660	hsa-miR-1827	CLIP-seq
MIRT1370661	hsa-miR-186	CLIP-seq
MIRT1370662	hsa-miR-1908	CLIP-seq
MIRT1370663	hsa-miR-1909	CLIP-seq
MIRT1370664	hsa-miR-1915	CLIP-seq
MIRT1370665	hsa-miR-195	CLIP-seq
MIRT1370666	hsa-miR-1976	CLIP-seq
MIRT1370667	hsa-miR-198	CLIP-seq
MIRT1370668	hsa-miR-216b	CLIP-seq
MIRT1370669	hsa-miR-224	CLIP-seq
MIRT1370670	hsa-miR-2276	CLIP-seq
MIRT1370671	hsa-miR-2355-5p	CLIP-seq
MIRT1370672	hsa-miR-23a	CLIP-seq
MIRT1370673	hsa-miR-23b	CLIP-seq
MIRT1370674	hsa-miR-23c	CLIP-seq
MIRT1370675	hsa-miR-2861	CLIP-seq
MIRT1370676	hsa-miR-302f	CLIP-seq
MIRT1370677	hsa-miR-3064-3p	CLIP-seq
MIRT1370678	hsa-miR-3117-5p	CLIP-seq
MIRT1370679	hsa-miR-3119	CLIP-seq
MIRT1370628	hsa-miR-3125	CLIP-seq
MIRT1370680	hsa-miR-3127-3p	CLIP-seq
MIRT1370681	hsa-miR-3133	CLIP-seq
MIRT1370682	hsa-miR-3144-5p	CLIP-seq
MIRT1370683	hsa-miR-3166	CLIP-seq
MIRT1370684	hsa-miR-3173-5p	CLIP-seq
MIRT1370685	hsa-miR-3175	CLIP-seq
MIRT1370629	hsa-miR-3184	CLIP-seq
MIRT1370686	hsa-miR-3186-3p	CLIP-seq
MIRT739144	hsa-miR-3187-5p	CLIP-seq
MIRT1370687	hsa-miR-3191	CLIP-seq
MIRT1370688	hsa-miR-3192	CLIP-seq
MIRT1370689	hsa-miR-3194-5p	CLIP-seq
MIRT1370630	hsa-miR-328	CLIP-seq
MIRT1370690	hsa-miR-3606	CLIP-seq
MIRT1370691	hsa-miR-3609	CLIP-seq
MIRT1370692	hsa-miR-3617	CLIP-seq
MIRT1370693	hsa-miR-3622a-3p	CLIP-seq
MIRT1370694	hsa-miR-3622b-3p	CLIP-seq
MIRT1370695	hsa-miR-3662	CLIP-seq
MIRT1370696	hsa-miR-3676	CLIP-seq
MIRT1370697	hsa-miR-3679-3p	CLIP-seq
MIRT1370698	hsa-miR-3689a-5p	CLIP-seq
MIRT1370699	hsa-miR-3689b	CLIP-seq
MIRT1370700	hsa-miR-3689e	CLIP-seq
MIRT1370701	hsa-miR-3689f	CLIP-seq
MIRT1370702	hsa-miR-370	CLIP-seq
MIRT1370703	hsa-miR-377	CLIP-seq
MIRT1370631	hsa-miR-3916	CLIP-seq
MIRT739149	hsa-miR-3919	CLIP-seq
MIRT1370704	hsa-miR-3938	CLIP-seq
MIRT739143	hsa-miR-3945	CLIP-seq
MIRT1370705	hsa-miR-3972	CLIP-seq
MIRT1370706	hsa-miR-3973	CLIP-seq
MIRT1370707	hsa-miR-3977	CLIP-seq
MIRT1370708	hsa-miR-409-3p	CLIP-seq
MIRT1370709	hsa-miR-412	CLIP-seq
MIRT1370632	hsa-miR-423-5p	CLIP-seq
MIRT1370710	hsa-miR-424	CLIP-seq
MIRT1370633	hsa-miR-4257	CLIP-seq
MIRT1370711	hsa-miR-4262	CLIP-seq
MIRT1370712	hsa-miR-4263	CLIP-seq
MIRT1370713	hsa-miR-4300	CLIP-seq
MIRT1370714	hsa-miR-432	CLIP-seq
MIRT1370715	hsa-miR-433	CLIP-seq
MIRT1370634	hsa-miR-4330	CLIP-seq
MIRT1370716	hsa-miR-4436b-3p	CLIP-seq
MIRT1370717	hsa-miR-4446-5p	CLIP-seq
MIRT1370718	hsa-miR-4457	CLIP-seq
MIRT1370719	hsa-miR-4459	CLIP-seq
MIRT1370720	hsa-miR-4476	CLIP-seq
MIRT1370721	hsa-miR-448	CLIP-seq
MIRT1370722	hsa-miR-4490	CLIP-seq
MIRT1370723	hsa-miR-4493	CLIP-seq
MIRT1370724	hsa-miR-4512	CLIP-seq
MIRT1370725	hsa-miR-4519	CLIP-seq
MIRT1370726	hsa-miR-4527	CLIP-seq
MIRT1370727	hsa-miR-4533	CLIP-seq
MIRT1370728	hsa-miR-455-5p	CLIP-seq
MIRT1370729	hsa-miR-4643	CLIP-seq
MIRT1370730	hsa-miR-4652-5p	CLIP-seq
MIRT1370731	hsa-miR-4661-3p	CLIP-seq
MIRT1370732	hsa-miR-4666-5p	CLIP-seq
MIRT1370733	hsa-miR-4667-3p	CLIP-seq
MIRT1370734	hsa-miR-4684-3p	CLIP-seq
MIRT1370735	hsa-miR-4685-5p	CLIP-seq
MIRT1370736	hsa-miR-4687-5p	CLIP-seq
MIRT1370737	hsa-miR-4688	CLIP-seq
MIRT1370738	hsa-miR-4690-3p	CLIP-seq
MIRT1370739	hsa-miR-4699-5p	CLIP-seq
MIRT1370740	hsa-miR-4700-3p	CLIP-seq
MIRT1370741	hsa-miR-4706	CLIP-seq
MIRT1370742	hsa-miR-4708-3p	CLIP-seq
MIRT1370743	hsa-miR-4731-5p	CLIP-seq
MIRT1370744	hsa-miR-4734	CLIP-seq
MIRT1370745	hsa-miR-4749-5p	CLIP-seq
MIRT1370746	hsa-miR-4753-3p	CLIP-seq
MIRT1370747	hsa-miR-4761-5p	CLIP-seq
MIRT1370748	hsa-miR-4763-3p	CLIP-seq
MIRT1370749	hsa-miR-4765	CLIP-seq
MIRT1370750	hsa-miR-4767	CLIP-seq
MIRT1370751	hsa-miR-4773	CLIP-seq
MIRT1370752	hsa-miR-4774-5p	CLIP-seq
MIRT1370753	hsa-miR-4786-3p	CLIP-seq
MIRT1370754	hsa-miR-493	CLIP-seq
MIRT1370755	hsa-miR-497	CLIP-seq
MIRT1370756	hsa-miR-501-3p	CLIP-seq
MIRT1370757	hsa-miR-502-3p	CLIP-seq
MIRT1370758	hsa-miR-513b	CLIP-seq
MIRT1370759	hsa-miR-513c	CLIP-seq
MIRT1370760	hsa-miR-514b-5p	CLIP-seq
MIRT1370761	hsa-miR-520g	CLIP-seq
MIRT1370762	hsa-miR-520h	CLIP-seq
MIRT1370763	hsa-miR-548ag	CLIP-seq
MIRT1370764	hsa-miR-548ah	CLIP-seq
MIRT1370765	hsa-miR-548ai	CLIP-seq
MIRT1370766	hsa-miR-548c-3p	CLIP-seq
MIRT1370767	hsa-miR-580	CLIP-seq
MIRT1370768	hsa-miR-589	CLIP-seq
MIRT1370769	hsa-miR-607	CLIP-seq
MIRT1370770	hsa-miR-616	CLIP-seq
MIRT1370771	hsa-miR-618	CLIP-seq
MIRT1370772	hsa-miR-641	CLIP-seq
MIRT1370773	hsa-miR-663	CLIP-seq
MIRT1370774	hsa-miR-671-5p	CLIP-seq
MIRT1370775	hsa-miR-759	CLIP-seq
MIRT1370776	hsa-miR-920	CLIP-seq
MIRT1370777	hsa-miR-939	CLIP-seq
MIRT1370778	hsa-miR-96	CLIP-seq
MIRT1553855	hsa-miR-4667-5p	CLIP-seq
MIRT1553856	hsa-miR-4700-5p	CLIP-seq
MIRT1553857	hsa-miR-4723-5p	CLIP-seq
MIRT1553858	hsa-miR-4728-5p	CLIP-seq
MIRT1553859	hsa-miR-637	CLIP-seq
MIRT739144	hsa-miR-3187-5p	CLIP-seq
MIRT739149	hsa-miR-3919	CLIP-seq
MIRT739143	hsa-miR-3945	CLIP-seq
MIRT2109994	hsa-miR-371b-5p	CLIP-seq
MIRT2109995	hsa-miR-4420	CLIP-seq
MIRT2109996	hsa-miR-4789-5p	CLIP-seq
MIRT2109997	hsa-miR-617	CLIP-seq
MIRT2109998	hsa-miR-619	CLIP-seq
MIRT2109999	hsa-miR-1236	CLIP-seq
MIRT2110000	hsa-miR-1910	CLIP-seq
MIRT1370664	hsa-miR-1915	CLIP-seq
MIRT2110001	hsa-miR-4303	CLIP-seq
MIRT1370750	hsa-miR-4767	CLIP-seq
MIRT1370679	hsa-miR-3119	CLIP-seq
MIRT1370680	hsa-miR-3127-3p	CLIP-seq
MIRT739144	hsa-miR-3187-5p	CLIP-seq
MIRT1370693	hsa-miR-3622a-3p	CLIP-seq
MIRT1370694	hsa-miR-3622b-3p	CLIP-seq
MIRT1370697	hsa-miR-3679-3p	CLIP-seq
MIRT739149	hsa-miR-3919	CLIP-seq
MIRT739143	hsa-miR-3945	CLIP-seq
MIRT1370709	hsa-miR-412	CLIP-seq
MIRT2333491	hsa-miR-4251	CLIP-seq
MIRT2110001	hsa-miR-4303	CLIP-seq
MIRT1370717	hsa-miR-4446-5p	CLIP-seq
MIRT2333492	hsa-miR-4505	CLIP-seq
MIRT2333493	hsa-miR-4646-5p	CLIP-seq
MIRT2109998	hsa-miR-619	CLIP-seq
MIRT1370635	hsa-miR-105	CLIP-seq
MIRT1370627	hsa-miR-1291	CLIP-seq
MIRT2440562	hsa-miR-1298	CLIP-seq
MIRT1370648	hsa-miR-146a	CLIP-seq
MIRT1370649	hsa-miR-146b-5p	CLIP-seq
MIRT1370666	hsa-miR-1976	CLIP-seq
MIRT1370668	hsa-miR-216b	CLIP-seq
MIRT1370628	hsa-miR-3125	CLIP-seq
MIRT1370629	hsa-miR-3184	CLIP-seq
MIRT1370630	hsa-miR-328	CLIP-seq
MIRT1370702	hsa-miR-370	CLIP-seq
MIRT1370631	hsa-miR-3916	CLIP-seq
MIRT1370707	hsa-miR-3977	CLIP-seq
MIRT1370632	hsa-miR-423-5p	CLIP-seq
MIRT1370633	hsa-miR-4257	CLIP-seq
MIRT2440563	hsa-miR-4310	CLIP-seq
MIRT1370715	hsa-miR-433	CLIP-seq
MIRT1370634	hsa-miR-4330	CLIP-seq
MIRT1370724	hsa-miR-4512	CLIP-seq
MIRT1370746	hsa-miR-4753-3p	CLIP-seq
MIRT2440564	hsa-miR-4786-5p	CLIP-seq
MIRT1370768	hsa-miR-589	CLIP-seq
MIRT2440565	hsa-miR-662	CLIP-seq
MIRT2440566	hsa-miR-769-5p	CLIP-seq
MIRT1370635	hsa-miR-105	CLIP-seq
MIRT1370638	hsa-miR-1206	CLIP-seq
MIRT2627683	hsa-miR-122	CLIP-seq
MIRT2109999	hsa-miR-1236	CLIP-seq
MIRT2627684	hsa-miR-1249	CLIP-seq
MIRT2627685	hsa-miR-1254	CLIP-seq
MIRT1370643	hsa-miR-1273f	CLIP-seq
MIRT1370644	hsa-miR-1284	CLIP-seq
MIRT2627686	hsa-miR-1287	CLIP-seq
MIRT1370627	hsa-miR-1291	CLIP-seq
MIRT2627687	hsa-miR-129-3p	CLIP-seq
MIRT2440562	hsa-miR-1298	CLIP-seq
MIRT1370646	hsa-miR-1305	CLIP-seq
MIRT2627688	hsa-miR-1323	CLIP-seq
MIRT2627689	hsa-miR-139-5p	CLIP-seq
MIRT2627690	hsa-miR-143	CLIP-seq
MIRT1370647	hsa-miR-145	CLIP-seq
MIRT1370648	hsa-miR-146a	CLIP-seq
MIRT1370649	hsa-miR-146b-5p	CLIP-seq
MIRT1370650	hsa-miR-1470	CLIP-seq
MIRT1370651	hsa-miR-153	CLIP-seq
MIRT1370660	hsa-miR-1827	CLIP-seq
MIRT2627691	hsa-miR-188-3p	CLIP-seq
MIRT2627692	hsa-miR-18a	CLIP-seq
MIRT2627693	hsa-miR-18b	CLIP-seq
MIRT2110000	hsa-miR-1910	CLIP-seq
MIRT2627694	hsa-miR-1914	CLIP-seq
MIRT1370666	hsa-miR-1976	CLIP-seq
MIRT2627695	hsa-miR-2110	CLIP-seq
MIRT2627696	hsa-miR-214	CLIP-seq
MIRT1370668	hsa-miR-216b	CLIP-seq
MIRT1370671	hsa-miR-2355-5p	CLIP-seq
MIRT1370677	hsa-miR-3064-3p	CLIP-seq
MIRT2627697	hsa-miR-3116	CLIP-seq
MIRT1370678	hsa-miR-3117-5p	CLIP-seq
MIRT1370628	hsa-miR-3125	CLIP-seq
MIRT2627698	hsa-miR-3126-5p	CLIP-seq
MIRT1370680	hsa-miR-3127-3p	CLIP-seq
MIRT2627699	hsa-miR-3135b	CLIP-seq
MIRT2627700	hsa-miR-3137	CLIP-seq
MIRT2627701	hsa-miR-3149	CLIP-seq
MIRT2627702	hsa-miR-3150a-3p	CLIP-seq
MIRT2627703	hsa-miR-3150a-5p	CLIP-seq
MIRT2627704	hsa-miR-3150b-5p	CLIP-seq
MIRT2627705	hsa-miR-3152-5p	CLIP-seq
MIRT1370684	hsa-miR-3173-5p	CLIP-seq
MIRT1370685	hsa-miR-3175	CLIP-seq
MIRT1370629	hsa-miR-3184	CLIP-seq
MIRT739144	hsa-miR-3187-5p	CLIP-seq
MIRT2627706	hsa-miR-3188	CLIP-seq
MIRT2627707	hsa-miR-326	CLIP-seq
MIRT1370630	hsa-miR-328	CLIP-seq
MIRT2627708	hsa-miR-330-5p	CLIP-seq
MIRT2627709	hsa-miR-331-5p	CLIP-seq
MIRT2627710	hsa-miR-338-3p	CLIP-seq
MIRT2627711	hsa-miR-3618	CLIP-seq
MIRT2627712	hsa-miR-3619-5p	CLIP-seq
MIRT2627713	hsa-miR-3651	CLIP-seq
MIRT2627714	hsa-miR-3657	CLIP-seq
MIRT2627715	hsa-miR-3664-3p	CLIP-seq
MIRT2627716	hsa-miR-3667-3p	CLIP-seq
MIRT2627717	hsa-miR-3685	CLIP-seq
MIRT2627718	hsa-miR-3686	CLIP-seq
MIRT1370698	hsa-miR-3689a-5p	CLIP-seq
MIRT1370699	hsa-miR-3689b	CLIP-seq
MIRT1370700	hsa-miR-3689e	CLIP-seq
MIRT1370701	hsa-miR-3689f	CLIP-seq
MIRT2627719	hsa-miR-3691-3p	CLIP-seq
MIRT1370702	hsa-miR-370	CLIP-seq
MIRT2627720	hsa-miR-371-5p	CLIP-seq
MIRT2109994	hsa-miR-371b-5p	CLIP-seq
MIRT1370703	hsa-miR-377	CLIP-seq
MIRT2627721	hsa-miR-384	CLIP-seq
MIRT2627722	hsa-miR-3907	CLIP-seq
MIRT2627723	hsa-miR-3909	CLIP-seq
MIRT1370631	hsa-miR-3916	CLIP-seq
MIRT739149	hsa-miR-3919	CLIP-seq
MIRT2627724	hsa-miR-3926	CLIP-seq
MIRT2627725	hsa-miR-3940-5p	CLIP-seq
MIRT2627726	hsa-miR-3942-3p	CLIP-seq
MIRT739143	hsa-miR-3945	CLIP-seq
MIRT1370707	hsa-miR-3977	CLIP-seq
MIRT1370632	hsa-miR-423-5p	CLIP-seq
MIRT1370633	hsa-miR-4257	CLIP-seq
MIRT2627727	hsa-miR-4261	CLIP-seq
MIRT2627728	hsa-miR-4267	CLIP-seq
MIRT2627729	hsa-miR-4268	CLIP-seq
MIRT2627730	hsa-miR-4276	CLIP-seq
MIRT2627731	hsa-miR-4293	CLIP-seq
MIRT2627732	hsa-miR-4305	CLIP-seq
MIRT2440563	hsa-miR-4310	CLIP-seq
MIRT1370715	hsa-miR-433	CLIP-seq
MIRT1370634	hsa-miR-4330	CLIP-seq
MIRT2627733	hsa-miR-4418	CLIP-seq
MIRT2627734	hsa-miR-4419a	CLIP-seq
MIRT2627735	hsa-miR-4422	CLIP-seq
MIRT2627736	hsa-miR-4433	CLIP-seq
MIRT2627737	hsa-miR-4448	CLIP-seq
MIRT1370718	hsa-miR-4457	CLIP-seq
MIRT1370719	hsa-miR-4459	CLIP-seq
MIRT2627738	hsa-miR-4469	CLIP-seq
MIRT1370720	hsa-miR-4476	CLIP-seq
MIRT1370721	hsa-miR-448	CLIP-seq
MIRT2333492	hsa-miR-4505	CLIP-seq
MIRT2627739	hsa-miR-4506	CLIP-seq
MIRT2627740	hsa-miR-4507	CLIP-seq
MIRT2627741	hsa-miR-4510	CLIP-seq
MIRT1370724	hsa-miR-4512	CLIP-seq
MIRT1370726	hsa-miR-4527	CLIP-seq
MIRT2627742	hsa-miR-4530	CLIP-seq
MIRT2627743	hsa-miR-4650-5p	CLIP-seq
MIRT2627744	hsa-miR-4652-3p	CLIP-seq
MIRT2627745	hsa-miR-4659a-3p	CLIP-seq
MIRT2627746	hsa-miR-4659a-5p	CLIP-seq
MIRT2627747	hsa-miR-4659b-3p	CLIP-seq
MIRT2627748	hsa-miR-4659b-5p	CLIP-seq
MIRT1370732	hsa-miR-4666-5p	CLIP-seq
MIRT1370733	hsa-miR-4667-3p	CLIP-seq
MIRT2627749	hsa-miR-4669	CLIP-seq
MIRT2627750	hsa-miR-4678	CLIP-seq
MIRT2627751	hsa-miR-4680-5p	CLIP-seq
MIRT1370736	hsa-miR-4687-5p	CLIP-seq
MIRT1370737	hsa-miR-4688	CLIP-seq
MIRT2627752	hsa-miR-4695-5p	CLIP-seq
MIRT2627753	hsa-miR-4698	CLIP-seq
MIRT2627754	hsa-miR-4708-5p	CLIP-seq
MIRT2627755	hsa-miR-4722-3p	CLIP-seq
MIRT2627756	hsa-miR-4731-3p	CLIP-seq
MIRT1370743	hsa-miR-4731-5p	CLIP-seq
MIRT2627757	hsa-miR-4733-5p	CLIP-seq
MIRT1370744	hsa-miR-4734	CLIP-seq
MIRT2627758	hsa-miR-4735-3p	CLIP-seq
MIRT1370746	hsa-miR-4753-3p	CLIP-seq
MIRT2627759	hsa-miR-4755-3p	CLIP-seq
MIRT1370747	hsa-miR-4761-5p	CLIP-seq
MIRT2627760	hsa-miR-4763-5p	CLIP-seq
MIRT1370750	hsa-miR-4767	CLIP-seq
MIRT2627761	hsa-miR-4768-3p	CLIP-seq
MIRT2627762	hsa-miR-4770	CLIP-seq
MIRT2627763	hsa-miR-4774-3p	CLIP-seq
MIRT2627764	hsa-miR-4778-3p	CLIP-seq
MIRT1370753	hsa-miR-4786-3p	CLIP-seq
MIRT2440564	hsa-miR-4786-5p	CLIP-seq
MIRT2627765	hsa-miR-4801	CLIP-seq
MIRT2627766	hsa-miR-494	CLIP-seq
MIRT1370756	hsa-miR-501-3p	CLIP-seq
MIRT1370757	hsa-miR-502-3p	CLIP-seq
MIRT2627767	hsa-miR-502-5p	CLIP-seq
MIRT2627768	hsa-miR-509-3-5p	CLIP-seq
MIRT2627769	hsa-miR-509-5p	CLIP-seq
MIRT1370758	hsa-miR-513b	CLIP-seq
MIRT1370759	hsa-miR-513c	CLIP-seq
MIRT1370760	hsa-miR-514b-5p	CLIP-seq
MIRT2627770	hsa-miR-515-5p	CLIP-seq
MIRT2627771	hsa-miR-517b	CLIP-seq
MIRT2627772	hsa-miR-526b	CLIP-seq
MIRT1370763	hsa-miR-548ag	CLIP-seq
MIRT1370765	hsa-miR-548ai	CLIP-seq
MIRT1370766	hsa-miR-548c-3p	CLIP-seq
MIRT2627773	hsa-miR-548o	CLIP-seq
MIRT2627774	hsa-miR-548s	CLIP-seq
MIRT2627775	hsa-miR-549	CLIP-seq
MIRT2627776	hsa-miR-552	CLIP-seq
MIRT2627777	hsa-miR-570	CLIP-seq
MIRT2627778	hsa-miR-579	CLIP-seq
MIRT1370767	hsa-miR-580	CLIP-seq
MIRT1370768	hsa-miR-589	CLIP-seq
MIRT2627779	hsa-miR-596	CLIP-seq
MIRT2627780	hsa-miR-603	CLIP-seq
MIRT1370769	hsa-miR-607	CLIP-seq
MIRT2627781	hsa-miR-609	CLIP-seq
MIRT1370771	hsa-miR-618	CLIP-seq
MIRT2109998	hsa-miR-619	CLIP-seq
MIRT2627782	hsa-miR-629	CLIP-seq
MIRT2627783	hsa-miR-633	CLIP-seq
MIRT2627784	hsa-miR-645	CLIP-seq
MIRT2627785	hsa-miR-646	CLIP-seq
MIRT2440565	hsa-miR-662	CLIP-seq
MIRT1370774	hsa-miR-671-5p	CLIP-seq
MIRT2627786	hsa-miR-676	CLIP-seq
MIRT2627787	hsa-miR-761	CLIP-seq
MIRT2627788	hsa-miR-767-5p	CLIP-seq
MIRT2440566	hsa-miR-769-5p	CLIP-seq
MIRT2627789	hsa-miR-875-3p	CLIP-seq
MIRT1370777	hsa-miR-939	CLIP-seq
MIRT1370635	hsa-miR-105	CLIP-seq
MIRT1370638	hsa-miR-1206	CLIP-seq
MIRT2109999	hsa-miR-1236	CLIP-seq
MIRT2627684	hsa-miR-1249	CLIP-seq
MIRT1370627	hsa-miR-1291	CLIP-seq
MIRT2440562	hsa-miR-1298	CLIP-seq
MIRT2627688	hsa-miR-1323	CLIP-seq
MIRT2627689	hsa-miR-139-5p	CLIP-seq
MIRT1370647	hsa-miR-145	CLIP-seq
MIRT1370648	hsa-miR-146a	CLIP-seq
MIRT1370649	hsa-miR-146b-5p	CLIP-seq
MIRT1370650	hsa-miR-1470	CLIP-seq
MIRT1370660	hsa-miR-1827	CLIP-seq
MIRT2627691	hsa-miR-188-3p	CLIP-seq
MIRT2627692	hsa-miR-18a	CLIP-seq
MIRT2627693	hsa-miR-18b	CLIP-seq
MIRT2627694	hsa-miR-1914	CLIP-seq
MIRT1370666	hsa-miR-1976	CLIP-seq
MIRT2627695	hsa-miR-2110	CLIP-seq
MIRT1370668	hsa-miR-216b	CLIP-seq
MIRT1370671	hsa-miR-2355-5p	CLIP-seq
MIRT1370677	hsa-miR-3064-3p	CLIP-seq
MIRT1370628	hsa-miR-3125	CLIP-seq
MIRT2627698	hsa-miR-3126-5p	CLIP-seq
MIRT1370680	hsa-miR-3127-3p	CLIP-seq
MIRT2627700	hsa-miR-3137	CLIP-seq
MIRT2627702	hsa-miR-3150a-3p	CLIP-seq
MIRT2627703	hsa-miR-3150a-5p	CLIP-seq
MIRT2627704	hsa-miR-3150b-5p	CLIP-seq
MIRT2627705	hsa-miR-3152-5p	CLIP-seq
MIRT1370684	hsa-miR-3173-5p	CLIP-seq
MIRT1370685	hsa-miR-3175	CLIP-seq
MIRT739144	hsa-miR-3187-5p	CLIP-seq
MIRT2627706	hsa-miR-3188	CLIP-seq
MIRT2691358	hsa-miR-323-5p	CLIP-seq
MIRT2627707	hsa-miR-326	CLIP-seq
MIRT1370630	hsa-miR-328	CLIP-seq
MIRT2627708	hsa-miR-330-5p	CLIP-seq
MIRT2627709	hsa-miR-331-5p	CLIP-seq
MIRT2627711	hsa-miR-3618	CLIP-seq
MIRT2627714	hsa-miR-3657	CLIP-seq
MIRT2627715	hsa-miR-3664-3p	CLIP-seq
MIRT2627716	hsa-miR-3667-3p	CLIP-seq
MIRT2627717	hsa-miR-3685	CLIP-seq
MIRT2627718	hsa-miR-3686	CLIP-seq
MIRT1370698	hsa-miR-3689a-5p	CLIP-seq
MIRT1370699	hsa-miR-3689b	CLIP-seq
MIRT1370700	hsa-miR-3689e	CLIP-seq
MIRT1370701	hsa-miR-3689f	CLIP-seq
MIRT2627719	hsa-miR-3691-3p	CLIP-seq
MIRT1370702	hsa-miR-370	CLIP-seq
MIRT2627720	hsa-miR-371-5p	CLIP-seq
MIRT2109994	hsa-miR-371b-5p	CLIP-seq
MIRT1370703	hsa-miR-377	CLIP-seq
MIRT2627721	hsa-miR-384	CLIP-seq
MIRT2627722	hsa-miR-3907	CLIP-seq
MIRT2627723	hsa-miR-3909	CLIP-seq
MIRT1370631	hsa-miR-3916	CLIP-seq
MIRT739149	hsa-miR-3919	CLIP-seq
MIRT2627725	hsa-miR-3940-5p	CLIP-seq
MIRT2627726	hsa-miR-3942-3p	CLIP-seq
MIRT739143	hsa-miR-3945	CLIP-seq
MIRT1370707	hsa-miR-3977	CLIP-seq
MIRT1370633	hsa-miR-4257	CLIP-seq
MIRT2627727	hsa-miR-4261	CLIP-seq
MIRT2627728	hsa-miR-4267	CLIP-seq
MIRT2627729	hsa-miR-4268	CLIP-seq
MIRT2627730	hsa-miR-4276	CLIP-seq
MIRT2691359	hsa-miR-4299	CLIP-seq
MIRT2440563	hsa-miR-4310	CLIP-seq
MIRT1370715	hsa-miR-433	CLIP-seq
MIRT1370634	hsa-miR-4330	CLIP-seq
MIRT2627734	hsa-miR-4419a	CLIP-seq
MIRT2627736	hsa-miR-4433	CLIP-seq
MIRT2627737	hsa-miR-4448	CLIP-seq
MIRT2691360	hsa-miR-4456	CLIP-seq
MIRT1370718	hsa-miR-4457	CLIP-seq
MIRT1370719	hsa-miR-4459	CLIP-seq
MIRT2627738	hsa-miR-4469	CLIP-seq
MIRT2627739	hsa-miR-4506	CLIP-seq
MIRT2627740	hsa-miR-4507	CLIP-seq
MIRT2627741	hsa-miR-4510	CLIP-seq
MIRT1370724	hsa-miR-4512	CLIP-seq
MIRT1370726	hsa-miR-4527	CLIP-seq
MIRT2627744	hsa-miR-4652-3p	CLIP-seq
MIRT2627745	hsa-miR-4659a-3p	CLIP-seq
MIRT2627746	hsa-miR-4659a-5p	CLIP-seq
MIRT2627747	hsa-miR-4659b-3p	CLIP-seq
MIRT2627748	hsa-miR-4659b-5p	CLIP-seq
MIRT1370732	hsa-miR-4666-5p	CLIP-seq
MIRT1370733	hsa-miR-4667-3p	CLIP-seq
MIRT2627749	hsa-miR-4669	CLIP-seq
MIRT2627750	hsa-miR-4678	CLIP-seq
MIRT1370737	hsa-miR-4688	CLIP-seq
MIRT2627752	hsa-miR-4695-5p	CLIP-seq
MIRT2627753	hsa-miR-4698	CLIP-seq
MIRT2627755	hsa-miR-4722-3p	CLIP-seq
MIRT2627756	hsa-miR-4731-3p	CLIP-seq
MIRT2627757	hsa-miR-4733-5p	CLIP-seq
MIRT1370744	hsa-miR-4734	CLIP-seq
MIRT2627758	hsa-miR-4735-3p	CLIP-seq
MIRT1370746	hsa-miR-4753-3p	CLIP-seq
MIRT1370747	hsa-miR-4761-5p	CLIP-seq
MIRT2627760	hsa-miR-4763-5p	CLIP-seq
MIRT1370750	hsa-miR-4767	CLIP-seq
MIRT2627761	hsa-miR-4768-3p	CLIP-seq
MIRT2627763	hsa-miR-4774-3p	CLIP-seq
MIRT2627764	hsa-miR-4778-3p	CLIP-seq
MIRT2440564	hsa-miR-4786-5p	CLIP-seq
MIRT2627765	hsa-miR-4801	CLIP-seq
MIRT2627766	hsa-miR-494	CLIP-seq
MIRT1370758	hsa-miR-513b	CLIP-seq
MIRT1370759	hsa-miR-513c	CLIP-seq
MIRT1370760	hsa-miR-514b-5p	CLIP-seq
MIRT2627771	hsa-miR-517b	CLIP-seq
MIRT2627773	hsa-miR-548o	CLIP-seq
MIRT2691361	hsa-miR-548q	CLIP-seq
MIRT2627775	hsa-miR-549	CLIP-seq
MIRT2627776	hsa-miR-552	CLIP-seq
MIRT2627777	hsa-miR-570	CLIP-seq
MIRT1370767	hsa-miR-580	CLIP-seq
MIRT1370768	hsa-miR-589	CLIP-seq
MIRT2627779	hsa-miR-596	CLIP-seq
MIRT2627780	hsa-miR-603	CLIP-seq
MIRT2109998	hsa-miR-619	CLIP-seq
MIRT2627782	hsa-miR-629	CLIP-seq
MIRT2627784	hsa-miR-645	CLIP-seq
MIRT2627785	hsa-miR-646	CLIP-seq
MIRT2440565	hsa-miR-662	CLIP-seq
MIRT2627786	hsa-miR-676	CLIP-seq
MIRT2627788	hsa-miR-767-5p	CLIP-seq
MIRT2440566	hsa-miR-769-5p	CLIP-seq
MIRT2627789	hsa-miR-875-3p	CLIP-seq
MIRT2691362	hsa-miR-876-3p	CLIP-seq
MIRT1370777	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
ARID1A	Unknown	21900401
TP53	Unknown	21900401
TRIB3	Unknown	21896644
WT1	Activation	20842112
WWTR1	Activation	22470139

Show/Hide all(205)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8774881, 28467929
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	14555988
GO:0000165	Process	MAPK cascade	IEA
GO:0000785	Component	Chromatin	IDA	21828274
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	9732876
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18832382, 21947082, 24378993, 31582430
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	21947082
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IC	21828274
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	21947082
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IMP	32141990
GO:0001217	Function	DNA-binding transcription repressor activity	IDA	28467929
GO:0001222	Function	Transcription corepressor binding	IPI	14612439
GO:0001223	Function	Transcription coactivator binding	IPI	16777850
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	24378993, 25605017
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	24378993, 26311719
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	24964035
GO:0001501	Process	Skeletal system development	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001657	Process	Ureteric bud development	IEA
GO:0001666	Process	Response to hypoxia	IMP	12411310
GO:0001701	Process	In utero embryonic development	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0001889	Process	Liver development	IEA
GO:0001947	Process	Heart looping	IEA
GO:0002076	Process	Osteoblast development	IEA
GO:0002520	Process	Immune system development	IEA
GO:0003677	Function	DNA binding	IDA	28467929
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9111321
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9732876, 10823886, 21947082
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	32141990
GO:0005160	Function	Transforming growth factor beta receptor binding	IPI	9311995
GO:0005515	Function	Protein binding	IPI	9865696, 9892009, 10681527, 11274402, 11278756, 11387212, 12154125, 14525983, 15051726, 15084259, 15231748, 15350224, 15588252, 15647271, 15897867, 16007207, 16200078, 17099224, 17292623, 17469184, 17785517, 18548003, 18568018, 18729074, 18832382, 19032343, 19049980, 19122240, 19135
GO:0005518	Function	Collagen binding	IEA
GO:0005634	Component	Nucleus	IDA	9311995, 12446380, 16007207, 21145499, 21947082, 25893292
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IGI	23723426
GO:0005637	Component	Nuclear inner membrane	IDA	15647271
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	21947082
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	IPI	25060702
GO:0005737	Component	Cytoplasm	IDA	9311995, 12446380, 21145499, 21947082
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IGI	23723426
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	25060702
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	35359452
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	21947082
GO:0006915	Process	Apoptotic process	IEA
GO:0006955	Process	Immune response	IMP	16886151
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9311995, 9732876, 10823886, 18548003, 21947082, 28467929
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	8774881
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	NAS	35359452
GO:0007254	Process	JNK cascade	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007492	Process	Endoderm development	IEA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008270	Function	Zinc ion binding	IDA	12686552
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	14555988
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0009880	Process	Embryonic pattern specification	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	21307346
GO:0010629	Process	Negative regulation of gene expression	IMP	24378993
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	21307346
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	18505915
GO:0016202	Process	Regulation of striated muscle tissue development	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	31023188
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0017151	Function	DEAD/H-box RNA helicase binding	IPI	18548003
GO:0019899	Function	Enzyme binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	12874272
GO:0019902	Function	Phosphatase binding	IPI	16751101
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030279	Process	Negative regulation of ossification	IDA	22155034
GO:0030308	Process	Negative regulation of cell growth	IDA	8774881
GO:0030325	Process	Adrenal gland development	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030878	Process	Thyroid gland development	IEA
GO:0031053	Process	Primary miRNA processing	TAS	19018011
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11278251, 15781469, 19122240
GO:0031962	Function	Nuclear mineralocorticoid receptor binding	IPI	12902338
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IEA
GO:0032502	Process	Developmental process	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032810	Function	Sterol response element binding	IGI	25605017
GO:0032909	Process	Regulation of transforming growth factor beta2 production	IMP	12411310
GO:0032916	Process	Positive regulation of transforming growth factor beta3 production	IEA
GO:0032924	Process	Activin receptor signaling pathway	IBA
GO:0032924	Process	Activin receptor signaling pathway	IMP	15150278
GO:0032924	Process	Activin receptor signaling pathway	NAS	15150278
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IPI	12902338
GO:0036064	Component	Ciliary basal body	IDA
GO:0038092	Process	Nodal signaling pathway	IMP	15150278
GO:0042060	Process	Wound healing	TAS	19018011
GO:0042110	Process	T cell activation	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042307	Process	Positive regulation of protein import into nucleus	NAS	15799969
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	18729074, 22045334
GO:0042803	Function	Protein homodimerization activity	IPI	8774881
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043130	Function	Ubiquitin binding	IDA	18794808
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29203640
GO:0043235	Component	Receptor complex	IMP	8774881
GO:0043425	Function	BHLH transcription factor binding	IPI	21828274
GO:0043565	Function	Sequence-specific DNA binding	IDA	10823886
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045216	Process	Cell-cell junction organization	IMP	18505915
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	27038547
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045596	Process	Negative regulation of cell differentiation	ISS
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	19816956
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9111321, 9311995, 9732876
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12676957, 17884155
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8774881, 18832382
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	14555988
GO:0046872	Function	Metal ion binding	IEA
GO:0048340	Process	Paraxial mesoderm morphogenesis	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048617	Process	Embryonic foregut morphogenesis	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050776	Process	Regulation of immune response	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0050927	Process	Positive regulation of positive chemotaxis	IEA
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	IDA	27038547
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0060039	Process	Pericardium development	IEA
GO:0060290	Process	Transdifferentiation	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IMP	15107418
GO:0060395	Process	SMAD protein signal transduction	IBA
GO:0060395	Process	SMAD protein signal transduction	IDA	9111321, 9311995, 9732876, 10823886
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060395	Process	SMAD protein signal transduction	IMP	30729664
GO:0061045	Process	Negative regulation of wound healing	IEA
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	9732876, 17251190
GO:0061767	Process	Negative regulation of lung blood pressure	IEA
GO:0070306	Process	Lens fiber cell differentiation	IEA
GO:0070410	Function	Co-SMAD binding	IPI	8774881, 9111321, 9311995, 9732876
GO:0070411	Function	I-SMAD binding	IBA
GO:0070412	Function	R-SMAD binding	IPI	9311995, 20129061
GO:0071141	Component	SMAD protein complex	IDA	18832382, 21947082
GO:0071144	Component	Heteromeric SMAD protein complex	IBA
GO:0071144	Component	Heteromeric SMAD protein complex	IDA	21828274
GO:0071144	Component	Heteromeric SMAD protein complex	NAS	16322555
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071559	Process	Response to transforming growth factor beta	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	12902338
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0097190	Process	Apoptotic signaling pathway	IMP	15107418
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	15334054
GO:0098586	Process	Cellular response to virus	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	21828274
GO:0141091	Process	Transforming growth factor beta receptor superfamily signaling pathway	IEA
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IDA	21307346
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IMP	30729664
GO:1902893	Process	Regulation of miRNA transcription	IC	25605017
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	32141990
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	24378993
GO:1902895	Process	Positive regulation of miRNA transcription	IMP	30729664
GO:1902895	Process	Positive regulation of miRNA transcription	IMP	24378993, 26311719
GO:1903243	Process	Negative regulation of cardiac muscle hypertrophy in response to stress	IEA
GO:1990776	Process	Response to angiotensin	IMP	30729664
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
603109	6769	ENSG00000166949

Protein

UniProt ID

P84022

Protein name

Mothers against decapentaplegic homolog 3 (MAD homolog 3) (Mad3) (Mothers against DPP homolog 3) (hMAD-3) (JV15-2) (SMAD family member 3) (SMAD 3) (Smad3) (hSMAD3)

Protein function

Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of man

PDB

1MHD , 1MJS , 1MK2 , 1OZJ , 1U7F , 2LAJ , 2LB2 , 5OD6 , 5ODG , 5XOC , 6YIB , 6ZMN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03165	MH1	31 → 131	MH1 domain	Domain
PF03166	MH2	230 → 401	MH2 domain	Family

Sequence

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS

Sequence length

425

Interactions

View interactions

Show/Hide Causal Diseases (6)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Aneurysm-Osteoarthritis Syndrome	aneurysm-osteoarthritis syndrome	rs757106110, rs587782977, rs1963050712, rs387906851, rs745672741, rs587776881, rs1595956832, rs1595941653, rs730880214, rs387906852, rs1595941823, rs1567005489, rs387906853, rs1595956416, rs1595956538 View all (8 more)	N/A
Connective Tissue Disease	Connective tissue disorder	rs730880214, rs745672741	N/A
Ehlers-Danlos Syndrome	ehlers-danlos syndrome	rs387906850	N/A
Loeys-Dietz Syndrome	loeys-dietz syndrome	rs730880214, rs1595960447, rs587782977, rs770098673	N/A
Thoracic Aortic Aneurysm And Aortic Dissection	familial thoracic aortic aneurysm and aortic dissection	rs1566999458, rs745672741, rs886041046, rs1595956832, rs1006530719, rs1291288543, rs1566999423, rs1555412070, rs1555412069, rs1566999601, rs863223759, rs753486471, rs587776881, rs1555413579, rs1566999610 View all (34 more)	N/A
neoplasm	Neoplasm	rs1060500766	N/A

Show/Hide Unknown Diseases (22)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Pediatric asthma, Asthma, Asthma onset (childhood vs adult), Asthma in any disease, Asthma (childhood onset), Asthma (moderate or severe), Nonatopic asthma, Atopic asthma, Asthma (adult onset)	N/A	N/A	GWAS
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Carcinoma	Basal cell carcinoma	N/A	N/A	GWAS
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Congenital Aneurysm Of Ascending Aorta	congenital aneurysm of ascending aorta	N/A	N/A	ClinVar
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Dermatitis	Atopic dermatitis	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Eosinophilia	Eosinophilic esophagitis	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease (MTAG), Inflammatory bowel disease	N/A	N/A	GWAS
Keratoconus	Keratoconus	N/A	N/A	GWAS
Lymphocytic Leukemia	Chronic lymphocytic leukemia	N/A	N/A	GWAS
Melanoma	Melanoma	SMAD3 drives phenotype switching and resistance to melanoma therapies	33724679	CBGDA
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Otosclerosis	Otosclerosis	N/A	N/A	GWAS
Thoracic Aortic Aneurysm	Isolated thoracic aortic aneurysm	N/A	N/A	ClinVar
thoracic aortic aneurysm	Thoracic aortic aneurysm	N/A	N/A	ClinVar
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (264)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abidi X linked mental retardation syndrome	Associate	28737528
Abortion Habitual	Associate	34030553
Abortion Spontaneous	Associate	34030553
Acute Aortic Syndrome	Associate	21778426
Acute Coronary Syndrome	Associate	29115576
Acute Kidney Injury	Associate	34795878
Adenocarcinoma	Inhibit	15016321
Adenocarcinoma	Associate	17264880
Adenocarcinoma of Lung	Associate	24928833, 25816405, 28115165, 35982471, 36861928
Adenomyosis	Associate	29253010
Airway Remodeling	Associate	27126693
Allergic Fungal Sinusitis	Associate	31664133
Alopecia	Associate	36982775
Alzheimer Disease	Associate	37253165
Amyloidosis Cerebroarterial App Related	Associate	28557134
Anemia Dyserythropoietic Congenital	Associate	32759740
Aneurysm	Associate	22633655, 24657066, 26221609, 34244757, 39382597
Angina Stable	Associate	15261933
Aortic Aneurysm Abdominal	Associate	21778426, 28665537
Aortic Aneurysm Familial Thoracic 1	Associate	21778426, 24657066, 29510914, 32597575
Aortic Aneurysm Thoracic	Associate	24804794, 26017485, 26854089, 32404006, 32597575
Aortic Diseases	Associate	24804794
Aortic Dissection	Associate	21778426, 24804794, 28855619, 30739908, 31489719, 31915033, 32022471, 35078481
Aortic Root Aneurysm	Associate	22633655, 32404006
Aortic Valve Stenosis	Associate	29227539
Arterial Tortuosity Syndrome	Associate	22633655, 32100971
Arteriosclerosis	Associate	16556868
Arteriovenous Malformations	Associate	36198763
Arthritis Rheumatoid	Associate	24204921, 24804794, 25376468, 32998457, 33362761
Ascending aortic aneurysm hypertelorism bifid uvula cleft palate and arterial tortuosity	Associate	32100971
Asthma	Associate	20860503, 26209277, 28011059, 30158495, 30472056, 30903795, 32065213, 33245228
Asthma	Inhibit	40650018
Atherosclerosis	Associate	11555647, 23468652, 24204921, 29512862, 29685964, 31900142, 33786633
Atrial Fibrillation	Associate	24144036
Autoimmune Diseases	Associate	24804794
Bone Diseases	Associate	17900349, 20362080, 20863401, 26160166
Brain Neoplasms	Associate	21778426, 37598220
Breast Neoplasms	Associate	11555647, 12628005, 15520018, 19943940, 20736297, 21114847, 24488910, 24528085, 25006666, 25205100, 25658913, 25744371, 26160166, 26686634, 26805406 View all (12 more)
Breast Neoplasms	Stimulate	39337574
Bronchiolitis Obliterans Syndrome	Associate	35185369
Bronchopulmonary Dysplasia	Associate	30001393
Carcinogenesis	Associate	20037158, 21625455, 22904681, 23991075, 24696849, 24714748, 25205100, 30137431, 35780128, 36072623
Carcinoma	Associate	29309308
Carcinoma Hepatocellular	Associate	23991075, 27236156, 28192402, 28245423, 28639733, 33036415, 33684566, 34257565, 34281492, 35123494, 35941537
Carcinoma Hepatocellular	Stimulate	31548493
Carcinoma Non Small Cell Lung	Associate	21515830, 25375657, 28115165, 30594196, 31773685, 31894278, 31894325, 33589523, 34628486, 34818944, 35348194, 37967345
Carcinoma Ovarian Epithelial	Associate	26091707
Carcinoma Pancreatic Ductal	Associate	21624123, 24709776, 32291413, 33782384, 35406724, 36207615
Carcinoma Renal Cell	Associate	27166254, 28626070, 36313180
Carcinoma Squamous Cell	Inhibit	28102840
Carcinoma Squamous Cell	Associate	37806311
Cardiomyopathies	Associate	39294340
Cardiomyopathy Dilated	Associate	21127203, 24804794, 37840136
Cardiomyopathy Hypertrophic	Associate	36878974
Cardiomyopathy Restrictive	Associate	35185369
Cardiovascular Diseases	Associate	31915033
Carotid Artery Diseases	Associate	24657066
Carotid Stenosis	Associate	24852296
Carpal Tunnel Syndrome	Associate	30927912
Cell Transformation Neoplastic	Inhibit	20037158
Cell Transformation Neoplastic	Associate	20736297
Charcot Marie Tooth Disease	Associate	24804794
Chemical and Drug Induced Liver Injury	Associate	27273381, 27990439
Cholangiocarcinoma	Associate	29569474, 37669935
Cholesteatoma	Associate	25922834
Cleft Palate	Associate	26795696, 32100971
Colitis Ulcerative	Associate	21530736, 26461477
Colonic Neoplasms	Associate	32420374, 37597669
Colorectal Neoplasms	Associate	21068203, 21071512, 21747928, 22539990, 24427302, 24696849, 25532000, 25541970, 26461477, 27776350, 28061442, 28414818, 30728352, 30931081, 31027226 View all (7 more)
Connective Tissue Diseases	Associate	25073432, 30675029
Coronary Aneurysm	Associate	21127203
Coronary Artery Disease	Associate	17634449, 24533640, 25528061, 27386823, 30146127, 30307970, 32513244, 35768776
Coronary Artery Dissection Spontaneous	Associate	33125268, 34939946, 40194966
Coronary Disease	Associate	21804106, 31014396, 34795878
Coronary Restenosis	Associate	19394554
Coronary Restenosis	Stimulate	24378993
Coronavirus Infections	Associate	33968364
Cough	Associate	19463161
COVID 19	Associate	34939946
Coxa Magna	Associate	30024590
Coxa Magna	Inhibit	32410637
Craniofacial Abnormalities	Associate	32100971
Crohn Disease	Associate	24461721, 29967250
Crohn Disease	Inhibit	31968593
Cystadenocarcinoma	Associate	18505915
Cystic Fibrosis	Associate	23632450, 25134464
Death	Associate	28841682
Death Sudden	Associate	24804794
Dermatitis Atopic	Associate	23436698, 38066678
Dermatitis Atopic 3	Associate	29729188
Desmoid disease hereditary	Associate	23035734
Diabetes Gestational	Associate	33890634
Diabetes Mellitus Type 2	Associate	19252133, 32747424
Diabetic Nephropathies	Associate	18508967, 32705273, 33043774, 35880624, 38537808
Digestive System Neoplasms	Associate	33036415
Dissection Thoracic Aorta	Associate	31211624, 32199657, 33648514
Drug Resistant Epilepsy	Associate	27861825
Duane Retraction Syndrome	Associate	24047375
Dupuytren Contracture	Associate	30927912
Dysgnathia complex	Associate	32100971
Endometrial Neoplasms	Associate	21771027, 26384307, 30276219, 30695033
Endometriosis	Inhibit	25228630
Endometriosis	Associate	30276219, 32348176
Endometriosis	Stimulate	36768775
Eosinophilic Esophagitis	Associate	28832026
Epidermolysis Bullosa Dystrophica	Associate	30684555
Esophageal Squamous Cell Carcinoma	Associate	30280774
Familial Primary Pulmonary Hypertension	Associate	25644172
Fanconi Syndrome	Associate	34110636
Fasciculation	Associate	23404842
Fibrocartilaginous embolism	Associate	31804973
Fibromatosis Aggressive	Associate	23035734
Fibrosis	Associate	16556868, 17317656, 18400984, 18508967, 26088859, 27328942, 27853248, 28918914, 29170419, 29570207, 30108174, 30729664, 31611175, 31695131, 32165595 View all (10 more)
Gallbladder Neoplasms	Associate	28611292
Genetic Diseases Inborn	Associate	29907982
Gingival Overgrowth	Associate	24445011
Glioblastoma	Associate	24759784, 25165192, 25315188, 25891822, 25991676, 29158223, 37357610
Glioma	Associate	25165192, 30320350, 35251569, 36181980, 36255058
Glomerulonephritis	Associate	11114293
Glomerulonephritis	Stimulate	17125594, 28815607
Glomerulonephritis IGA	Stimulate	19693466
Glomerulosclerosis Focal Segmental	Associate	14531804
Granulosa Cell Tumor	Associate	23322721, 24416423, 28727617, 32641411, 33639972
Granulosa cell tumor of the ovary	Associate	28727617
Hashimoto Disease	Associate	24804794
Heart Defects Congenital	Associate	26110764, 27218255
Heart Failure	Associate	23640436, 30272299
Heart Failure	Inhibit	37840136
Heart Septal Defects Ventricular	Associate	26110764
Hematoma	Associate	24657066
Hereditary Breast and Ovarian Cancer Syndrome	Associate	28678584
HIV Infections	Associate	33013899
Hypertension	Associate	33647858
Hypertrophy	Associate	33713570, 35406794, 36185336
Hypoxia	Inhibit	19951945
Hypoxia	Associate	21209004
Hypoxia	Stimulate	27909731, 31925944
Hypoxia Brain	Associate	19951945, 21209004
Idiopathic Pulmonary Fibrosis	Associate	22241478, 25476248, 30709904, 37416778
Idiopathic Pulmonary Fibrosis	Stimulate	38117249
Iliac Aneurysm	Associate	33969386
Immunoglobulin G4 Related Disease	Associate	12974945
Inflammation	Associate	20860503, 22726420, 23632450, 24144036, 26461477, 27060571, 28011059, 29512862, 32447340, 37588593, 38537808
Inflammatory Bowel Diseases	Associate	21530736, 29547621
Inflammatory Bowel Diseases	Stimulate	34561227
Insulin Resistance	Associate	38088865
Intervertebral disc disease	Associate	24551286
Intracranial Aneurysm	Associate	21778426, 31096651
Intracranial Arteriovenous Malformations	Associate	36198763
Iridogoniodysgenesis and skeletal anomalies	Associate	32100971
Joint Diseases	Associate	25376468
Juvenile polyposis syndrome	Associate	10446110
Keloid	Associate	27909731
Keratoconus	Associate	25247416
Kidney Diseases	Associate	17125594
Kidney Diseases	Inhibit	24475278
Laryngitis	Associate	32100971
Leiomyoma	Associate	19700613
Leukemia Biphenotypic Acute	Associate	32509885
Leukemia Lymphoma Adult T Cell	Associate	12393612
Leukemia Myeloid Acute	Associate	28454099, 33073700
Leukemia Prolymphocytic T Cell	Associate	33596640
Lichen Planus Oral	Associate	14675171
Liver Cirrhosis	Associate	27273381
Liver Failure	Associate	29690860
Loeys Dietz Syndrome	Associate	21778426, 22633655, 22975338, 24583347, 24852296, 25163805, 26221609, 26333736, 31096651, 31784499, 31915033, 32022471, 32100971, 32273946, 33059708 View all (9 more)
Lung Diseases	Associate	22659883, 25476248, 32457348, 33589523
Lung Neoplasms	Associate	22693540, 22904681, 35998480, 36508813, 36626550, 37121971
Lung Neoplasms	Stimulate	30594196
Lupus Erythematosus Systemic	Associate	19020994
Lymphatic Metastasis	Stimulate	24709776
Lymphoma Large B Cell Diffuse	Associate	40302006
Macular Degeneration	Associate	31700227
Mandibular Diseases	Associate	32100971
Marfan Syndrome	Associate	25644172, 31096651
Melanoma	Associate	21477078, 33154524, 33724679
Melorheostosis	Associate	32289153
Mesothelioma	Associate	25557874
Mesothelioma Malignant	Associate	25557874
Mucocutaneous Lymph Node Syndrome	Associate	21127203, 24652666
Muscular Dystrophy Duchenne	Associate	32359374
Myocardial Infarction	Associate	38290462
Nasal Polyps	Associate	28779150
Nasopharyngeal Carcinoma	Associate	25578496, 29393436, 33122398
Nasopharyngeal Neoplasms	Associate	25578496
Neoplasm Metastasis	Associate	23591524, 25056536, 25205100, 25578496, 25766320, 26384307, 27992365, 28611292, 31626590, 34196584, 35085106, 35342355, 35413833, 36008860, 37682272
Neoplasm Metastasis	Stimulate	25409617
Neoplasms	Associate	18172167, 18505915, 19257827, 20037158, 21477078, 22492723, 22539990, 23035734, 23866946, 23918305, 24709776, 24890385, 25006666, 25056536, 25205100 View all (40 more)
Neoplasms	Inhibit	22899882, 24627133, 26160166, 36812239
Neoplasms	Stimulate	30594196
Neoplasms Glandular and Epithelial	Associate	12161428
Nerve Degeneration	Associate	24551286
Netherton Syndrome	Stimulate	19693466
Neuroendocrine Tumors	Associate	26578390
Neurologic Manifestations	Associate	24804794
Obesity	Associate	24040759, 28211912, 38088865
Obesity	Stimulate	32108968
Oncogene Addiction	Associate	36626550
Osteoarthritis	Associate	20650323, 22633655, 22820497, 22975338, 24257415, 24583347, 24657066, 24804794, 24852296, 24873879, 26221609, 26261637, 26395178, 28356485, 28934396 View all (5 more)
Osteoarthritis Hip	Associate	22820497, 29310478
Osteoarthritis Knee	Associate	26068512, 29315792
Osteophyte	Associate	24852296
Osteoporosis	Associate	36443839
Osteoradionecrosis	Associate	21726429
Ovarian Diseases	Associate	18505915
Ovarian Neoplasms	Associate	18505915, 24416423, 35053353, 35342355, 36072623
Pancreatic Neoplasms	Associate	17114344, 25409617, 27473228, 33782384, 34155232, 35854234, 36207615, 36401386, 38058074
Pancreatitis	Associate	27473228
Pelvic Organ Prolapse	Associate	29737911
Penile Induration	Associate	23770939
Peripheral Arterial Occlusive Disease 1	Associate	19394554
Peripheral Nervous System Diseases	Associate	24804794
Peritoneal Diseases	Associate	32823722
Personality Disorders	Associate	36207615
Pituitary Neoplasms	Associate	24636138
Pleural Effusion Malignant	Associate	30118648
Polycystic Kidney Autosomal Dominant	Associate	19259356
Polycystic Ovary Syndrome	Associate	27132594
Polycythemia Vera	Associate	35427808, 39511342
Polyps	Associate	33036415
postintensive care syndrome	Associate	25516419
Prodromal Symptoms	Associate	19955655
Prostatic Neoplasms	Associate	11248024, 12226080, 17579118, 19257827, 22843506, 24627133, 25056536, 27384993, 29164579, 29257105, 30209539, 32364525, 36536346, 36727462
Prostatitis	Associate	11248024
Pulmonary Arterial Hypertension	Associate	30274147
Pulmonary Disease Chronic Obstructive	Associate	19087346, 20463300, 27060571, 27126693, 33510050, 39456887
Pulmonary Fibrosis	Associate	29207055, 33495816, 33601175, 33760151
Pyruvate Carboxylase Deficiency Disease	Associate	35197444
Radiation Injuries	Associate	37723905
Rectal Neoplasms	Associate	26934318
Renal Artery Obstruction	Stimulate	24378993
Renal Insufficiency Chronic	Associate	16686760, 32957963
Respiratory Sounds	Associate	29729188
Respiratory Tract Infections	Associate	25408144
Schizophrenia Spectrum and Other Psychotic Disorders	Associate	28737528
Scleroderma Systemic	Associate	24578173
Short Stature Idiopathic Autosomal	Associate	33713570
Sjogren's Syndrome	Associate	24804794
Smooth Muscle Tumor	Associate	17468136
Squamous Cell Carcinoma of Head and Neck	Associate	33593111, 34060226, 37691034
Status Asthmaticus	Associate	28011059
Stomach Neoplasms	Associate	22539990, 24260584, 27383203, 28165563, 30896889, 33036415, 33538080, 34138687, 35458126, 37328880
Stroke	Associate	24204921, 31096651
Tertiary Lymphoid Structures	Associate	37682272
Thoracic Diseases	Associate	36007983
Thrombophlebitis	Associate	21478096
Thyroid Cancer Papillary	Associate	23591524, 23918305, 28039715, 29300379
Thyroid Carcinoma Anaplastic	Associate	32138807
Thyroid Neoplasms	Associate	28195142, 29300379, 38165228
Triple Negative Breast Neoplasms	Associate	28678584, 34326372, 36123344
Urinary Bladder Neoplasms	Associate	26873485, 28837140, 31198976, 34196584, 38129585
Urinary Bladder Neurogenic	Stimulate	35662268
Uterine Cervical Neoplasms	Associate	27206216, 31626590, 33098235, 37667176
Uterine Diseases	Associate	32348176
Varicose Veins	Associate	21478096
Vascular Diseases	Associate	21778426, 34939946, 39382597
Vascular Remodeling	Associate	33647858
Ventricular Remodeling	Associate	27126693, 38290462
Vitreoretinopathy Proliferative	Associate	31700227
Warburg Sjo Fledelius syndrome	Associate	32100971
Weight Loss	Stimulate	24404136
White Dot Syndromes	Associate	31700227
Wilms Tumor	Associate	31035970
Wounds and Injuries	Associate	28356485

SMAD3 (SMAD family member 3)