Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs
Entrez ID	6543
Gene name	Solute carrier family 8 member A2
Gene symbol	SLC8A2
Synonyms (NCBI Gene)	NCX2
Chromosome	19
Chromosome location	19q13.32

Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736487	hsa-miR-206	Luciferase reporter assayWestern blottingqRT-PCR	32075715
MIRT1368453	hsa-miR-1268	CLIP-seq
MIRT1368454	hsa-miR-1268b	CLIP-seq
MIRT1368455	hsa-miR-3190	CLIP-seq
MIRT1368456	hsa-miR-3681	CLIP-seq
MIRT1368457	hsa-miR-4488	CLIP-seq
MIRT1368458	hsa-miR-451b	CLIP-seq
MIRT1368459	hsa-miR-4697-5p	CLIP-seq
MIRT1368460	hsa-miR-4767	CLIP-seq
MIRT1368461	hsa-miR-585	CLIP-seq
MIRT2109510	hsa-miR-3663-3p	CLIP-seq
MIRT2109511	hsa-miR-4260	CLIP-seq
MIRT2109512	hsa-miR-4283	CLIP-seq
MIRT2109513	hsa-miR-4300	CLIP-seq
MIRT2109514	hsa-miR-4489	CLIP-seq
MIRT2109515	hsa-miR-4656	CLIP-seq
MIRT2109516	hsa-miR-4663	CLIP-seq
MIRT2109517	hsa-miR-920	CLIP-seq

Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002931	Process	Response to ischemia	IEA
GO:0002931	Process	Response to ischemia	ISS
GO:0005432	Function	Calcium:sodium antiporter activity	IBA
GO:0005432	Function	Calcium:sodium antiporter activity	IEA
GO:0005432	Function	Calcium:sodium antiporter activity	ISS
GO:0005432	Function	Calcium:sodium antiporter activity	TAS
GO:0005516	Function	Calmodulin binding	IEA
GO:0005886	Component	Plasma membrane	IC
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0007154	Process	Cell communication	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0007612	Process	Learning	IEA
GO:0007612	Process	Learning	ISS
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010468	Process	Regulation of gene expression	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0015081	Function	Sodium ion transmembrane transporter activity	ISS	8021246
GO:0015085	Function	Calcium ion transmembrane transporter activity	IEA
GO:0015085	Function	Calcium ion transmembrane transporter activity	ISS
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0035725	Process	Sodium ion transmembrane transport	IBA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0035725	Process	Sodium ion transmembrane transport	ISS	8021246
GO:0042383	Component	Sarcolemma	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0043679	Component	Axon terminus	ISS
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048172	Process	Regulation of short-term neuronal synaptic plasticity	IEA
GO:0048172	Process	Regulation of short-term neuronal synaptic plasticity	ISS
GO:0050808	Process	Synapse organization	IEA
GO:0050808	Process	Synapse organization	ISS
GO:0050890	Process	Cognition	IEA
GO:0050890	Process	Cognition	ISS
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0070050	Process	Neuron cellular homeostasis	IEA
GO:0070050	Process	Neuron cellular homeostasis	ISS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	ISS	8021246
GO:0098703	Process	Calcium ion import across plasma membrane	IBA
GO:0098793	Component	Presynapse	IDA	21382638
GO:0098794	Component	Postsynapse	IBA
GO:0098815	Process	Modulation of excitatory postsynaptic potential	IEA
GO:0098815	Process	Modulation of excitatory postsynaptic potential	ISS
GO:0099566	Process	Regulation of postsynaptic cytosolic calcium ion concentration	IEA
GO:0099608	Process	Regulation of action potential firing pattern	IEA
GO:0099608	Process	Regulation of action potential firing pattern	ISS
GO:0106056	Process	Regulation of calcineurin-mediated signaling	IEA
GO:0106056	Process	Regulation of calcineurin-mediated signaling	ISS
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	ISS
GO:1903779	Process	Regulation of cardiac conduction	IEA
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1905060	Function	Calcium:monoatomic cation antiporter activity involved in regulation of postsynaptic cytosolic calcium ion concentration	ISS
GO:1990034	Process	Calcium ion export across plasma membrane	IEA
GO:1990034	Process	Calcium ion export across plasma membrane	ISS

MIM	HGNC	e!Ensembl
601901	11069	ENSG00000118160

Q9UPR5

Protein name

Sodium/calcium exchanger 2 (Na(+)/Ca(2+)-exchange protein 2) (Solute carrier family 8 member 2)

Protein function

Mediates the electrogenic exchange of Ca(2+) against Na(+) ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent cellular processes. Contributes to cellular Ca(2+) homeostasis

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01699	Na_Ca_ex	74 → 245	Sodium/calcium exchanger protein	Family
PF16494	Na_Ca_ex_C	248 → 379	C-terminal extension of sodium/calcium exchanger domain	Family
PF03160	Calx-beta	384 → 483	Calx-beta domain	Domain
PF03160	Calx-beta	512 → 612	Calx-beta domain	Domain
PF01699	Na_Ca_ex	747 → 912	Sodium/calcium exchanger protein	Family

Sequence

MAPLALVGVTLLLAAPPCSGAATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
IYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGELGGLGP
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEARRIAEMGKPVLGENCRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEEDGSREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFL
GLWLLYILFASLEAYCHIRGF

Sequence length

921

Interactions

View interactions

SLC8A2 (solute carrier family 8 member A2)