Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	6580
Gene name	Solute carrier family 22 member 1
Gene symbol	SLC22A1
Synonyms (NCBI Gene)	HOCT1OCT1oct1_cds
Chromosome	6
Chromosome location	6q25.3
Summary	Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT646165	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT646164	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT646163	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT646162	hsa-miR-4275	HITS-CLIP	23824327
MIRT646161	hsa-miR-3941	HITS-CLIP	23824327
MIRT646160	hsa-miR-4672	HITS-CLIP	23824327
MIRT646159	hsa-miR-466	HITS-CLIP	23824327
MIRT646165	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT646164	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT646163	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT646162	hsa-miR-4275	HITS-CLIP	23824327
MIRT646161	hsa-miR-3941	HITS-CLIP	23824327
MIRT646160	hsa-miR-4672	HITS-CLIP	23824327
MIRT646159	hsa-miR-466	HITS-CLIP	23824327

100

Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005277	Function	Acetylcholine transmembrane transporter activity	IDA	15817714
GO:0005277	Function	Acetylcholine transmembrane transporter activity	IEA
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	12439218, 24688079, 24961373, 35469921
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IEA
GO:0005330	Function	Dopamine:sodium symporter activity	IEA
GO:0005334	Function	Norepinephrine:sodium symporter activity	IEA
GO:0005515	Function	Protein binding	IPI	11543633, 21988832, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9187257
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006836	Process	Neurotransmitter transport	IDA	24688079
GO:0006837	Process	Serotonin transport	IDA	12439218, 24961373, 35469921
GO:0006837	Process	Serotonin transport	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	9260930, 12439218, 24688079, 24961373, 35469921
GO:0008504	Function	Monoamine transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11907186
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	EXP	19141712
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	9260930, 17460754, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS	9187257
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IEA
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IEA
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IMP	20477935
GO:0015234	Function	Thiamine transmembrane transporter activity	IEA
GO:0015489	Function	Putrescine transmembrane transporter activity	IDA	21128598
GO:0015489	Function	Putrescine transmembrane transporter activity	IEA
GO:0015606	Function	Spermidine transmembrane transporter activity	IEA
GO:0015606	Function	Spermidine transmembrane transporter activity	ISS
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	23567998
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IEA
GO:0015695	Process	Organic cation transport	IBA
GO:0015695	Process	Organic cation transport	IDA	22806583, 24291757
GO:0015695	Process	Organic cation transport	IEA
GO:0015695	Process	Organic cation transport	TAS	9187257
GO:0015697	Process	Quaternary ammonium group transport	IDA	23567998
GO:0015697	Process	Quaternary ammonium group transport	IEA
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0015844	Process	Monoamine transport	IDA	35469921
GO:0015844	Process	Monoamine transport	IEA
GO:0015847	Process	Putrescine transport	IDA	21128598
GO:0015848	Process	Spermidine transport	IEA
GO:0015848	Process	Spermidine transport	ISS
GO:0015870	Process	Acetylcholine transport	IDA	15817714
GO:0015870	Process	Acetylcholine transport	IEA
GO:0015872	Process	Dopamine transport	IDA	35469921
GO:0015872	Process	Dopamine transport	IEA
GO:0015874	Process	Norepinephrine transport	IDA	24688079
GO:0015874	Process	Norepinephrine transport	IEA
GO:0015888	Process	Thiamine transport	IDA	24961373, 35469921
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9187257
GO:0016323	Component	Basolateral plasma membrane	IDA	12719534
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	TAS
GO:0016324	Component	Apical plasma membrane	IDA	15817714, 19536068, 20477935, 23680637, 28362799
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IDA	16263091
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	22806583, 24291757
GO:0019534	Function	Toxin transmembrane transporter activity	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IMP	20477935
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042908	Process	Xenobiotic transport	IDA	9260930, 11408531, 15389554, 22806583, 24291757, 35469921
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042908	Process	Xenobiotic transport	IMP	20477935, 28362799
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	9260930, 11408531, 15389554, 35469921
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	20477935, 28362799
GO:0048241	Process	Epinephrine transport	IDA	35469921
GO:0048241	Process	Epinephrine transport	IEA
GO:0051610	Process	Serotonin uptake	IDA	24688079
GO:0051610	Process	Serotonin uptake	IEA
GO:0051620	Process	Norepinephrine uptake	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071934	Process	Thiamine transmembrane transport	IDA	24961373, 35469921
GO:0071934	Process	Thiamine transmembrane transport	IEA
GO:0072237	Process	Metanephric proximal tubule development	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	TAS
GO:0090494	Process	Dopamine uptake	IDA	24688079
GO:0090494	Process	Dopamine uptake	IEA
GO:0098655	Process	Monoatomic cation transmembrane transport	IEA
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1901235	Function	(R)-carnitine transmembrane transporter activity	IEA
GO:1902270	Process	(R)-carnitine transmembrane transport	IEA
GO:1902616	Process	O-acyl-L-carnitine transmembrane transport	IEA
GO:1903711	Process	Spermidine transmembrane transport	IEA
GO:1990748	Process	Cellular detoxification	IDA	22806583, 24291757
GO:1990748	Process	Cellular detoxification	IEA
GO:1990748	Process	Cellular detoxification	IMP	20477935
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	NAS	20477935

MIM	HGNC	e!Ensembl
602607	10963	ENSG00000175003

O15245

Protein name

Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)

Protein function

Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:11388889, PubMed:11408531, PubMed:12439218, PubMed:12719534, PubMe

PDB

8ET6 , 8ET7 , 8ET8 , 8JTS , 8JTT , 8JTV , 8JTW , 8JTX , 8JTY , 8JTZ , 8JU0 , 8SC1 , 8SC2 , 8SC3 , 8SC4 , 8SC6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	89 → 371	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with high level in liver (PubMed:11388889, PubMed:23680637, PubMed:9187257, PubMed:9260930). In liver, expressed around the central vein (PubMed:16263091). Expressed in kidney (PubMed:9187257, PubMed:9260930). Expresse

Sequence

MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLKVQTSEPSGT

Sequence length

554

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Aganglionic megacolon	Uncertain significance	rs768905186	RCV000984701

Show/Hide Text Mining Associations (59)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	15751072
Breast Neoplasms	Stimulate	18550719
Burkitt Lymphoma	Associate	27407111
Carcinogenesis	Associate	40026294
Carcinoma Hepatocellular	Associate	22439694, 26872727, 28178663, 30628708, 31953214, 36881382, 37722628
Cardiotoxicity	Associate	38547766
Colonic Neoplasms	Associate	35167937
Communicable Diseases	Associate	35456416
Death	Associate	27799064
Developmental Disabilities	Associate	27799064
Diabetes Mellitus	Associate	24145224, 26464716, 28947922, 35167937
Diabetes Mellitus Type 2	Associate	19336679, 20639304, 24145224, 26464716, 26605869, 30041690, 35893047, 36734726, 40004467
Diarrhea	Associate	28817838
Disruptive Impulse Control and Conduct Disorders	Associate	32710539
Dizziness	Associate	37894954
Drug Related Side Effects and Adverse Reactions	Associate	26605869, 35456416
Dyslexia	Associate	19325871
Endocrine Gland Neoplasms	Associate	18550719
Esophageal Squamous Cell Carcinoma	Associate	35365176
Fructose Intolerance	Associate	27493135
Gastrointestinal Diseases	Associate	26605869
Herpes Simplex	Associate	32650799
Hodgkin Disease	Associate	16648862
Hyperlipidemia Familial Combined	Associate	7753827
Hypoglycemia	Associate	25025077
Infections	Associate	22524831
Inflammation	Associate	27117051
Insulin Resistance	Associate	24145224
Isolated Noncompaction of the Ventricular Myocardium	Associate	27799064
Leukemia	Associate	28025785
Leukemia Lymphocytic Chronic B Cell	Associate	24117365, 36077209
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23223357, 23272163, 28154092, 29567937, 33075481
Leukemia Myeloid Acute	Inhibit	28025785
Leukemia Myeloid Chronic Phase	Associate	22207690
Leukodystrophy Metachromatic	Associate	23261988
Liver Cirrhosis	Associate	27543206
Lymphoma Large Cell Anaplastic	Associate	16648862
Lymphoma Primary Effusion	Associate	25631079
Mandibuloacral dysplasia with type A lipodystrophy	Associate	25324471
Metabolic Diseases	Associate	18390905
Metabolic Side Effects of Drugs and Substances	Associate	25510240
Muscle Hypotonia	Associate	27799064
Myocardial Infarction	Associate	28408323
Neoplasm Invasiveness	Associate	26872727
Neoplasm Metastasis	Associate	28025785, 36982681
Neoplasms	Associate	12133827, 22439694, 22524831, 23144633, 24145224, 25849721, 26145173, 26861753, 27407111, 28025785, 28178663, 31953214, 40026294
Obesity	Stimulate	20956498
Obesity	Associate	27407018
Pancreatitis	Associate	29949790
Parkinson Disease	Associate	20680652
Pituitary Diseases	Stimulate	18550719
Polycystic Ovary Syndrome	Associate	30959948
Postoperative Nausea and Vomiting	Associate	28470102
Prostatic Neoplasms	Associate	17679089, 19058140
Respiratory Insufficiency	Associate	28470102
Stroke	Associate	31391037
Uterine Cervical Neoplasms	Associate	22524831
Virilism	Associate	21575951
Weight Loss	Associate	27407018

SLC22A1 (solute carrier family 22 member 1)