Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23411
Gene name Gene Name - the full gene name approved by the HGNC.
Sirtuin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SIRT1
Synonyms (NCBI Gene) Gene synonyms aliases
SIR2, SIR2L1, SIR2alpha
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002098 hsa-miR-34a-5p Western blot 18834855
MIRT002098 hsa-miR-34a-5p Western blot, Luciferase reporter assay, Northern blot 18755897
MIRT002098 hsa-miR-34a-5p Western blot, Luciferase reporter assay, Northern blot 18755897
MIRT002098 hsa-miR-34a-5p qRT-PCR, Luciferase reporter assay, Western blot 18834855
MIRT002098 hsa-miR-34a-5p Review, Luciferase reporter assay 19461653
Transcription factors
Transcription factor Regulation Reference
ATF4 Activation 22363646
ATF4 Repression 21801305
BRCA1 Activation 18851829;20160719;21407215;9000507
CIITA Repression 22064865
DDIT3 Repression 21801305
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000012 Process Single strand break repair IMP 20097625
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12535671, 15692560, 20955178
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 21947282
GO:0000183 Process RDNA heterochromatin assembly IDA 18485871
GO:0000183 Process RDNA heterochromatin assembly TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604479 14929 ENSG00000096717
Protein
UniProt ID Q96EB6
Protein name NAD-dependent protein deacetylase sirtuin-1 (hSIRT1) (EC 2.3.1.286) (NAD-dependent protein deacylase sirtuin-1) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 1) (SIR2-like protein 1) (hSIR2) [Cleaved into: SirtT1 75 kDa fragment (75SirT1)]
Protein function NAD-dependent protein deacetylase that links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separated cellular functions such as cell cycle, response to DNA damage, metabolism, apo
PDB 4I5I , 4IF6 , 4IG9 , 4KXQ , 4ZZH , 4ZZI , 4ZZJ , 5BTR , 8ANB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02146 SIR2 261 447 Sir2 family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10381378}.
Sequence
MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRP
VALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAINEAISVKQEVTDMNYPSNKS
Sequence length 747
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Atrial Fibrillation Atrial Fibrillation GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acrocephalosyndactylia Associate 30158377
Acute Coronary Syndrome Inhibit 23382833, 25342474
Acute Coronary Syndrome Associate 25342474
Acute Kidney Injury Inhibit 30980521
Acute Kidney Injury Associate 38062807
Acute Lung Injury Associate 25972997, 35853732
Adenocarcinoma Associate 19649206, 25915617, 33341453
Adenocarcinoma of Lung Associate 19649206, 30841451, 37898426
Adrenal Cortex Neoplasms Associate 33650791
Aging Premature Associate 35811457, 38004107