Gene Gene information from NCBI Gene database.
Entrez ID 6385
Gene name Syndecan 4
Gene symbol SDC4
Synonyms (NCBI Gene)
SYND4
Chromosome 20
Chromosome location 20q13.12
Summary The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene i
miRNA miRNA information provided by mirtarbase database.
1116
miRTarBase ID miRNA Experiments Reference
MIRT002795 hsa-miR-1-3p Microarray 15685193
MIRT022356 hsa-miR-124-3p Microarray 18668037
MIRT002795 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT002795 hsa-miR-1-3p Microarray 15685193
MIRT438457 hsa-miR-18a-5p Luciferase reporter assayqRT-PCR 25089138
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
POU2F1 Unknown 19212692
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0001657 Process Ureteric bud development IEA
GO:0001843 Process Neural tube closure IEA
GO:0001968 Function Fibronectin binding IEA
GO:0005080 Function Protein kinase C binding IEA
GO:0005515 Function Protein binding IPI 12571249, 18093920, 19350579, 25416956, 30282023, 32296183, 33961781, 34069441
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600017 10661 ENSG00000124145
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P31431
Protein name Syndecan-4 (SYND4) (Amphiglycan) (Ryudocan core protein)
Protein function Cell surface proteoglycan which regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413).
PDB 1EJP , 1EJQ , 1OBY , 1YBO , 8BLV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 139 196 Syndecan domain Family
Tissue specificity TISSUE SPECIFICITY: Detected in fibroblasts (at protein level) (PubMed:1500433, PubMed:36213313). Also expressed in epithelial cells (PubMed:1500433). {ECO:0000269|PubMed:1500433, ECO:0000269|PubMed:36213313}.
Sequence
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEF
YA
Sequence length 198
Interactions View interactions