Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6383
Gene name Gene Name - the full gene name approved by the HGNC.
Syndecan 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDC2
Synonyms (NCBI Gene) Gene synonyms aliases
CD362, HSPG, HSPG1, SYND2
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT468760 hsa-miR-495-3p PAR-CLIP 23592263
MIRT468759 hsa-miR-5688 PAR-CLIP 23592263
MIRT468758 hsa-miR-7-1-3p PAR-CLIP 23592263
MIRT468757 hsa-miR-7-2-3p PAR-CLIP 23592263
MIRT468756 hsa-miR-3125 PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 9660868, 11356864, 18093920, 22660413, 32296183, 32814053, 33961781
GO:0005788 Component Endoplasmic reticulum lumen TAS
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142460 10659 ENSG00000169439
Protein
UniProt ID P34741
Protein name Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)
Protein function Cell surface proteoglycan which regulates dendritic arbor morphogenesis.
PDB 6ITH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 138 199 Syndecan domain Family
Sequence
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEF
YA
Sequence length 201
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Stress Disorder Post-traumatic stress disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 23327652, 34397867
Adenocarcinoma of Lung Associate 30106131
Adenoma Associate 28058013, 28753106, 36203138
Adenoma Stimulate 29730903
Adenoma Villous Associate 29730903
Adenomatous Polyps Associate 29225717
Arrest of spermatogenesis Associate 39285301
Arthritis Associate 17545191
Azoospermia Associate 39285301
Breast Neoplasms Associate 19383343, 23327652, 24357546, 25623282