Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6382
Gene name Gene Name - the full gene name approved by the HGNC.
Syndecan 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDC1
Synonyms (NCBI Gene) Gene synonyms aliases
CD138, SDC, SYND1, syndecan
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p24.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007072 hsa-miR-10b-5p Luciferase reporter assay 22573479
MIRT019998 hsa-miR-375 Microarray 20215506
MIRT021459 hsa-miR-9-5p Microarray 17612493
MIRT045538 hsa-miR-149-5p CLASH 23622248
MIRT052912 hsa-miR-143-3p Luciferase reporter assay, qRT-PCR, Western blot 24722758
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 16132527
RELA Activation 16132527
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15292202, 16982797, 18093920, 23395182, 32814053, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 2324102
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
186355 10658 ENSG00000115884
Protein
UniProt ID P18827
Protein name Syndecan-1 (SYND1) (CD antigen CD138)
Protein function Cell surface proteoglycan that contains both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix (By similarity). Regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413). Ab
PDB 4GVC , 4GVD , 6EJE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 245 308 Syndecan domain Family
Tissue specificity TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Detected in fibroblasts (at protein level) (PubMed:36213313). {ECO:0000269|PubMed:32337544, ECO:0000269|PubMed:36213313}.
Sequence
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
KPTKQEEF
YA
Sequence length 310
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Long QT Syndrome long qt syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Stimulate 23988031
Adenocarcinoma Associate 18590537
Adenoma Associate 26972718
Adenoma Oxyphilic Associate 21630196
AIDS Associated Nephropathy Associate 10090942
Airway Obstruction Stimulate 31695352
Alzheimer Disease Associate 30718543
Ameloblastoma Associate 25690860, 28390135, 29850393, 33917771, 38504068
Ameloblastoma Inhibit 30151060
Amyloidosis Associate 19135901