Gene Gene information from NCBI Gene database.
Entrez ID 6382
Gene name Syndecan 1
Gene symbol SDC1
Synonyms (NCBI Gene)
CD138SDCSYND1syndecan
Chromosome 2
Chromosome location 2p24.1
Summary The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req
miRNA miRNA information provided by mirtarbase database.
412
miRTarBase ID miRNA Experiments Reference
MIRT007072 hsa-miR-10b-5p Luciferase reporter assay 22573479
MIRT019998 hsa-miR-375 Microarray 20215506
MIRT021459 hsa-miR-9-5p Microarray 17612493
MIRT045538 hsa-miR-149-5p CLASH 23622248
MIRT052912 hsa-miR-143-3p Luciferase reporter assayqRT-PCRWestern blot 24722758
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
NFKB1 Activation 16132527
RELA Activation 16132527
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15292202, 16982797, 18093920, 23395182, 32814053, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 2324102
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
186355 10658 ENSG00000115884
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P18827
Protein name Syndecan-1 (SYND1) (CD antigen CD138)
Protein function Cell surface proteoglycan that contains both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix (By similarity). Regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413). Ab
PDB 4GVC , 4GVD , 6EJE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 245 308 Syndecan domain Family
Tissue specificity TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Detected in fibroblasts (at protein level) (PubMed:36213313). {ECO:0000269|PubMed:32337544, ECO:0000269|PubMed:36213313}.
Sequence
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
KPTKQEEF
YA
Sequence length 310
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Long QT syndrome Likely benign rs777304384 RCV000190182
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Stimulate 23988031
Adenocarcinoma Associate 18590537
Adenoma Associate 26972718
Adenoma Oxyphilic Associate 21630196
AIDS Associated Nephropathy Associate 10090942
Airway Obstruction Stimulate 31695352
Alzheimer Disease Associate 30718543
Ameloblastoma Associate 25690860, 28390135, 29850393, 33917771, 38504068
Ameloblastoma Inhibit 30151060
Amyloidosis Associate 19135901