Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6330
Gene name Gene Name - the full gene name approved by the HGNC.
Sodium voltage-gated channel beta subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SCN4B
Synonyms (NCBI Gene) Gene synonyms aliases
ATFB17, LQT10, Navbeta4
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. De
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs112363898 T>A Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant, intron variant
rs121434386 G>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs149868494 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Missense variant, genic upstream transcript variant, coding sequence variant
rs587777559 A>C Pathogenic Coding sequence variant, missense variant, non coding transcript variant
rs587777560 T>G Pathogenic Coding sequence variant, missense variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023310 hsa-miR-122-5p Microarray 17612493
MIRT1330109 hsa-let-7a CLIP-seq
MIRT1330110 hsa-let-7b CLIP-seq
MIRT1330111 hsa-let-7c CLIP-seq
MIRT1330112 hsa-let-7d CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001518 Component Voltage-gated sodium channel complex IBA
GO:0001518 Component Voltage-gated sodium channel complex IDA 12930796, 17592081
GO:0001518 Component Voltage-gated sodium channel complex IMP 24297919
GO:0005248 Function Voltage-gated sodium channel activity IDA 12930796
GO:0005248 Function Voltage-gated sodium channel activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608256 10592 ENSG00000177098
Protein
UniProt ID Q8IWT1
Protein name Sodium channel regulatory subunit beta-4
Protein function Regulatory subunit of multiple voltage-gated sodium (Nav) channels directly mediating the depolarization of excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by swi
PDB 4MZ2 , 4MZ3 , 5XAW , 6VSV , 7DTD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 37 151 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at a high level in dorsal root ganglia, at a lower level in brain, spinal cord, skeletal muscle and heart. Expressed in the atrium. {ECO:0000269|PubMed:12930796, ECO:0000269|PubMed:21051419}.
Sequence
MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQV
VDRLEEVDNTVTLIILAVVGGVIGLLILI
LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV
Sequence length 228
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Atrial Fibrillation Atrial fibrillation, familial, 17 rs587777559, rs587777560 N/A
Long QT Syndrome long qt syndrome 10 rs121434386 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cardiomyopathy Primary dilated cardiomyopathy N/A N/A ClinVar
Catecholaminergic Polymorphic Ventricular Tachycardia Catecholaminergic polymorphic ventricular tachycardia 1 N/A N/A ClinVar
Congenital Long QT Syndrome congenital long qt syndrome N/A N/A ClinVar
Preeclampsia Preeclampsia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 37826914
Atrial Fibrillation Associate 30821358
Bipolar Disorder Associate 26554713
Brugada Syndrome Associate 31627867
Epilepsy Temporal Lobe Associate 32331418
Gallbladder Neoplasms Associate 40527859
Infratentorial Neoplasms Associate 33902636
Long QT Syndrome Associate 17592081, 19029296
Long QT syndrome type 3 Associate 17592081
Neoplasms Inhibit 32833340