Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6324
Gene name Gene Name - the full gene name approved by the HGNC.	Sodium voltage-gated channel beta subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SCN1B
Synonyms (NCBI Gene) Gene synonyms aliases	ATFB13, BRGDA5, DEE52, EIEE52, GEFSP1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ATFB13, BRGDA5, DEE52, GEFSP1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.11
Summary Summary of gene provided in NCBI Entrez Gene.	Voltage-gated sodium channels are heteromeric proteins that function in the generation and propagation of action potentials in muscle and neuronal cells. They are composed of one alpha and two beta subunits, where the alpha subunit provides channel activi

Show/Hide all(20)

SNP ID	Visualize variation	Clinical significance	Consequence
rs16969925	G>A	Pathogenic	Coding sequence variant, missense variant
rs66876876	G>A	Benign-likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance	Intron variant, coding sequence variant, missense variant
rs72552027	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity, benign-likely-benign	Coding sequence variant, genic upstream transcript variant, missense variant, upstream transcript variant
rs72558026	G>A	Benign, conflicting-interpretations-of-pathogenicity, uncertain-significance	Intron variant, coding sequence variant, missense variant
rs72558028	G>A,C	Likely-benign, benign, benign-likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance	Intron variant, coding sequence variant, missense variant
rs104894718	C>A,G,T	Pathogenic-likely-pathogenic, pathogenic, likely-pathogenic	Synonymous variant, coding sequence variant, missense variant, stop gained
rs121434627	G>A,C,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs193922728	G>A	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, intron variant
rs267607028	G>A	Pathogenic, uncertain-significance	Coding sequence variant, stop gained, intron variant
rs267607029	G>A	Pathogenic	Coding sequence variant, stop gained, intron variant
rs369032304	G>A,T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, intron variant
rs724159982	A>C	Pathogenic	Splice acceptor variant
rs786205830	C>T	Conflicting-interpretations-of-pathogenicity, likely-pathogenic	Missense variant, coding sequence variant
rs786205837	G>A	Pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs794727487	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs931949929	A>G,T	Pathogenic	Missense variant, coding sequence variant
rs1057519457	A>T	Pathogenic	Coding sequence variant, missense variant
rs1064794589	C>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1135401736	C>T	Pathogenic	Coding sequence variant, missense variant
rs1600364712	T>G	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016821	hsa-miR-335-5p	Microarray	18185580
MIRT047007	hsa-miR-210-3p	CLASH	23622248
MIRT038411	hsa-miR-296-3p	CLASH	23622248
MIRT531887	hsa-miR-136-3p	PAR-CLIP	22012620
MIRT531886	hsa-miR-6785-3p	PAR-CLIP	22012620
MIRT531885	hsa-miR-6801-3p	PAR-CLIP	22012620
MIRT531884	hsa-miR-6810-3p	PAR-CLIP	22012620
MIRT531883	hsa-miR-6752-3p	PAR-CLIP	22012620
MIRT531882	hsa-miR-6846-3p	PAR-CLIP	22012620
MIRT531880	hsa-miR-4755-3p	PAR-CLIP	22012620
MIRT531881	hsa-miR-4632-3p	PAR-CLIP	22012620
MIRT531887	hsa-miR-136-3p	PAR-CLIP	22012620
MIRT531886	hsa-miR-6785-3p	PAR-CLIP	22012620
MIRT531885	hsa-miR-6801-3p	PAR-CLIP	22012620
MIRT531884	hsa-miR-6810-3p	PAR-CLIP	22012620
MIRT531883	hsa-miR-6752-3p	PAR-CLIP	22012620
MIRT531882	hsa-miR-6846-3p	PAR-CLIP	22012620
MIRT531880	hsa-miR-4755-3p	PAR-CLIP	22012620
MIRT531881	hsa-miR-4632-3p	PAR-CLIP	22012620
MIRT1329755	hsa-miR-1224-3p	CLIP-seq
MIRT1329756	hsa-miR-1321	CLIP-seq
MIRT1329757	hsa-miR-1322	CLIP-seq
MIRT1329758	hsa-miR-138	CLIP-seq
MIRT1329759	hsa-miR-1913	CLIP-seq
MIRT1329760	hsa-miR-3144-5p	CLIP-seq
MIRT1329761	hsa-miR-3147	CLIP-seq
MIRT1329762	hsa-miR-324-3p	CLIP-seq
MIRT1329763	hsa-miR-342-5p	CLIP-seq
MIRT1329764	hsa-miR-3922-5p	CLIP-seq
MIRT1329765	hsa-miR-4270	CLIP-seq
MIRT1329766	hsa-miR-4299	CLIP-seq
MIRT1329767	hsa-miR-4313	CLIP-seq
MIRT1329768	hsa-miR-4433	CLIP-seq
MIRT1329769	hsa-miR-4441	CLIP-seq
MIRT1329770	hsa-miR-4466	CLIP-seq
MIRT1329771	hsa-miR-4514	CLIP-seq
MIRT1329772	hsa-miR-4649-5p	CLIP-seq
MIRT1329773	hsa-miR-4664-5p	CLIP-seq
MIRT1329774	hsa-miR-4692	CLIP-seq
MIRT1329775	hsa-miR-4706	CLIP-seq
MIRT1329776	hsa-miR-4710	CLIP-seq
MIRT1329777	hsa-miR-4722-5p	CLIP-seq
MIRT1329778	hsa-miR-4726-3p	CLIP-seq
MIRT1329779	hsa-miR-4728-5p	CLIP-seq
MIRT1329780	hsa-miR-4739	CLIP-seq
MIRT1329781	hsa-miR-4749-5p	CLIP-seq
MIRT1329782	hsa-miR-4756-5p	CLIP-seq
MIRT1329783	hsa-miR-4779	CLIP-seq
MIRT1329784	hsa-miR-4792	CLIP-seq
MIRT1329785	hsa-miR-486-3p	CLIP-seq
MIRT1329786	hsa-miR-5095	CLIP-seq
MIRT1329787	hsa-miR-675	CLIP-seq
MIRT1329788	hsa-miR-744	CLIP-seq
MIRT1329789	hsa-miR-765	CLIP-seq
MIRT1329790	hsa-miR-922	CLIP-seq
MIRT1329761	hsa-miR-3147	CLIP-seq
MIRT1329772	hsa-miR-4649-5p	CLIP-seq
MIRT1329777	hsa-miR-4722-5p	CLIP-seq
MIRT1329779	hsa-miR-4728-5p	CLIP-seq
MIRT1329785	hsa-miR-486-3p	CLIP-seq
MIRT2322048	hsa-miR-1254	CLIP-seq
MIRT2322049	hsa-miR-3116	CLIP-seq
MIRT2322050	hsa-miR-3937	CLIP-seq
MIRT2322051	hsa-miR-4254	CLIP-seq
MIRT2322052	hsa-miR-4488	CLIP-seq
MIRT2322053	hsa-miR-4697-5p	CLIP-seq
MIRT2322054	hsa-miR-4731-5p	CLIP-seq
MIRT2322055	hsa-miR-4746-3p	CLIP-seq
MIRT1329785	hsa-miR-486-3p	CLIP-seq
MIRT2322056	hsa-miR-550a	CLIP-seq
MIRT2322057	hsa-miR-637	CLIP-seq
MIRT2322058	hsa-miR-661	CLIP-seq
MIRT2322048	hsa-miR-1254	CLIP-seq
MIRT2394087	hsa-miR-185	CLIP-seq
MIRT2322049	hsa-miR-3116	CLIP-seq
MIRT2322050	hsa-miR-3937	CLIP-seq
MIRT2322051	hsa-miR-4254	CLIP-seq
MIRT2394088	hsa-miR-4306	CLIP-seq
MIRT2322052	hsa-miR-4488	CLIP-seq
MIRT2394089	hsa-miR-4644	CLIP-seq
MIRT2322053	hsa-miR-4697-5p	CLIP-seq
MIRT2322054	hsa-miR-4731-5p	CLIP-seq
MIRT2322055	hsa-miR-4746-3p	CLIP-seq
MIRT1329785	hsa-miR-486-3p	CLIP-seq
MIRT2322056	hsa-miR-550a	CLIP-seq
MIRT2322057	hsa-miR-637	CLIP-seq
MIRT2322058	hsa-miR-661	CLIP-seq
MIRT2458923	hsa-miR-2467-5p	CLIP-seq
MIRT2458924	hsa-miR-3160-5p	CLIP-seq
MIRT2458925	hsa-miR-3188	CLIP-seq
MIRT2458926	hsa-miR-3921	CLIP-seq
MIRT2458927	hsa-miR-3975	CLIP-seq
MIRT2458928	hsa-miR-4314	CLIP-seq
MIRT2458929	hsa-miR-4522	CLIP-seq
MIRT2458930	hsa-miR-4649-3p	CLIP-seq
MIRT2458931	hsa-miR-4653-5p	CLIP-seq
MIRT2458932	hsa-miR-4667-5p	CLIP-seq
MIRT2458933	hsa-miR-4700-5p	CLIP-seq
MIRT2458934	hsa-miR-4714-5p	CLIP-seq
MIRT2458935	hsa-miR-485-5p	CLIP-seq
MIRT2322057	hsa-miR-637	CLIP-seq

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001518	Component	Voltage-gated sodium channel complex	IBA	21873635
GO:0001518	Component	Voltage-gated sodium channel complex	IDA	8125980, 19808477, 21051419, 30190309
GO:0005244	Function	Voltage-gated ion channel activity	IEA
GO:0005248	Function	Voltage-gated sodium channel activity	IDA	19808477
GO:0005515	Function	Protein binding	IPI	26900580, 30190309
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	19710327, 30190309
GO:0007155	Process	Cell adhesion	IEA
GO:0007411	Process	Axon guidance	ISS
GO:0010765	Process	Positive regulation of sodium ion transport	IDA	19808477
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0014704	Component	Intercalated disc	ISS
GO:0017080	Function	Sodium channel regulator activity	IDA	8125980, 18464934, 19710327, 19808477
GO:0019227	Process	Neuronal action potential propagation	ISS
GO:0019871	Function	Sodium channel inhibitor activity	IBA	21873635
GO:0019871	Function	Sodium channel inhibitor activity	ISS	17884088
GO:0021966	Process	Corticospinal neuron axon guidance	ISS
GO:0030315	Component	T-tubule	ISS
GO:0033268	Component	Node of Ranvier	ISS
GO:0035725	Process	Sodium ion transmembrane transport	IDA	18464934, 19808477, 21051419
GO:0040011	Process	Locomotion	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0044325	Function	Ion channel binding	IBA	21873635
GO:0046684	Process	Response to pyrethroid	IEA
GO:0051899	Process	Membrane depolarization	IDA	21051419
GO:0060048	Process	Cardiac muscle contraction	IMP	19808477
GO:0060307	Process	Regulation of ventricular cardiac muscle cell membrane repolarization	ISS	17884088
GO:0060371	Process	Regulation of atrial cardiac muscle cell membrane depolarization	IMP	19808477, 22247482
GO:0061337	Process	Cardiac conduction	ISS
GO:0061337	Process	Cardiac conduction	TAS
GO:0086002	Process	Cardiac muscle cell action potential involved in contraction	IBA	21873635
GO:0086002	Process	Cardiac muscle cell action potential involved in contraction	IMP	19808477
GO:0086006	Function	Voltage-gated sodium channel activity involved in cardiac muscle cell action potential	IMP	19808477
GO:0086012	Process	Membrane depolarization during cardiac muscle cell action potential	ISS	17884088
GO:0086047	Process	Membrane depolarization during Purkinje myocyte cell action potential	IMP	18464934
GO:0086062	Function	Voltage-gated sodium channel activity involved in Purkinje myocyte action potential	IMP	18464934
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IBA	21873635
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IMP	19808477
GO:1905150	Process	Regulation of voltage-gated sodium channel activity	IEA
GO:2000649	Process	Regulation of sodium ion transmembrane transporter activity	IBA	21873635
GO:2000649	Process	Regulation of sodium ion transmembrane transporter activity	IDA	19808477

MIM	HGNC	e!Ensembl
600235	10586	ENSG00000105711

Protein

UniProt ID

Q07699

Protein name

Sodium channel regulatory subunit beta-1

Protein function

Regulatory subunit of multiple voltage-gated sodium (Nav) channels directly mediating the depolarization of excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by swi

PDB

6AGF , 6J8G , 6J8H , 6J8I , 6J8J , 7W77 , 7W7F , 7W9K , 7W9L , 7W9M , 7W9P , 7W9T , 7XM9 , 7XMF , 7XMG , 7XVE , 7XVF , 8FHD , 8G1A , 8GZ1 , 8GZ2 , 8I5B , 8I5G , 8I5X , 8I5Y , 8J4F , 8S9B , 8S9C , 8THG , 8THH , 8XMM , 8XMN , 8XMO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	23 → 146	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: The overall expression of isoform 1 and isoform 2 is very similar. Isoform 1 is abundantly expressed in skeletal muscle, heart and brain. Isoform 2 is highly expressed in brain and skeletal muscle and present at a very low level in hea

Sequence

MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFR
QKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYE
CHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIY
CYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE

Sequence length

218

Interactions

View interactions

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Source
Unknown
Developmental And Epileptic Encephalopathy	genetic developmental and epileptic encephalopathy, developmental and epileptic encephalopathy, 52	GenCC
Heart Block	progressive familial heart block	GenCC
Epilepsy With Febrile Seizures Plus	generalized epilepsy with febrile seizures plus, type 1	GenCC
Atrial Fibrillation	atrial fibrillation, familial, 13	GenCC
Brugada Syndrome	Brugada syndrome 1	GenCC

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining
Arrhythmias Cardiac	Associate	18464934, 25253298, 27707468, 34583279, 35752364, 38139087
Atrial Fibrillation	Associate	20558140, 38139087
Brain Diseases	Associate	33901312
Brugada Syndrome	Associate	25253298, 27707468, 31627867, 34034907, 34583279
Cardiomyopathy Hypertrophic	Associate	38139087
Charcot Marie Tooth Disease Dominant Intermediate B	Associate	34034907
Colorectal Neoplasms	Associate	32207560
Disease	Associate	18464934
Drug Resistant Epilepsy	Associate	19270815, 27094248, 34583279
Epilepsies Myoclonic	Associate	23148524, 28102593, 28681755, 30921204, 31709768, 34583279
Epilepsy	Associate	29056246, 29466837, 34583279, 35752364, 35801810, 36288729, 40191585
Epilepsy Idiopathic Generalized	Associate	14738422, 36374051
Epileptic Encephalopathy Early Infantile 3	Associate	31709768, 36571524
Epileptic Syndromes	Associate	25253298
Frasier Syndrome	Associate	31729702
Generalized Epilepsy With Febrile Seizures Plus Type 1	Associate	10486327, 11254444, 14738422, 15827091, 35886038, 36288729
Hearing Loss	Associate	31709768
Heart Diseases	Associate	18464934, 32529721, 35205305
Heterotaxy Syndrome	Associate	38139087
Infantile Epileptic Dyskinetic Encephalopathy	Associate	31709768
Irritable Bowel Syndrome	Associate	34034907
Liddle Syndrome	Associate	38013303
Long QT Syndrome	Associate	18052691, 34583279
Mohr Tranebjaerg syndrome	Associate	27094248
Neoplasms	Associate	35752364
Neuropathy Painful	Associate	32877464
Opioid Induced Constipation	Associate	34034907
Otitis Media	Associate	21857919
Seizures	Associate	31709768
Seizures Febrile	Associate	12086636, 19292758, 34583279
Status Epilepticus	Associate	31709768
Wolf Hirschhorn Syndrome	Associate	28102593

SCN1B (sodium voltage-gated channel beta subunit 1)