Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6257
Gene name Gene Name - the full gene name approved by the HGNC.
Retinoid X receptor beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RXRB
Synonyms (NCBI Gene) Gene synonyms aliases
DAUDI6, H-2RIIBP, NR2B2, RCoR-1, RXR-beta, RXRbeta
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptor
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004176 hsa-miR-197-3p Microarray 16822819
MIRT004235 hsa-miR-346 Microarray 16822819
MIRT016771 hsa-miR-335-5p Microarray 18185580
MIRT028819 hsa-miR-26b-5p Microarray 19088304
MIRT051998 hsa-let-7b-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 12767074
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 12767074
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
180246 10478 ENSG00000204231
Protein
UniProt ID P28702
Protein name Retinoic acid receptor RXR-beta (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta)
Protein function Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR
PDB 1H9U , 1UHL , 5HJP , 5I4V , 5KYA , 5KYJ , 7A78
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 203 272 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 331 513 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in aortic endothelial cells (at protein level) (PubMed:28167758). Expressed in monocytes (PubMed:26463675). Expressed in a variety of tumor cell lines. {ECO:0000269|PubMed:26463675, ECO:0000269|PubMed:28167758, ECO:0000269|Pu
Sequence
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKR
EAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLI
GDTPIDTFLMEMLEAPHQLA
Sequence length 533
Interactions View interactions