Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	861
Gene name	RUNX family transcription factor 1
Gene symbol	RUNX1
Synonyms (NCBI Gene)	AML1AML1-EVI-1AMLCR1CBF2alphaCBFA2EVI-1PEBP2aBPEBP2alpha
Chromosome	21
Chromosome location	21q22.12
Summary	Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of norm

Show/Hide all (40)

SNP ID	Visualize variation	Clinical significance	Consequence
rs74315450	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121912498	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121912499	G>A,C,T	Pathogenic, likely-pathogenic, likely-benign	Non coding transcript variant, coding sequence variant, stop gained, synonymous variant, genic downstream transcript variant
rs121912500	G>T	Pathogenic, likely-benign	Missense variant, non coding transcript variant, coding sequence variant
rs150042294	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant, missense variant, non coding transcript variant, coding sequence variant
rs561166961	C>A	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs761390141	C>A,G,T	Conflicting-interpretations-of-pathogenicity	3 prime UTR variant, genic downstream transcript variant
rs769628054	G>A	Conflicting-interpretations-of-pathogenicity	Synonymous variant, downstream transcript variant, genic downstream transcript variant, coding sequence variant
rs1057519748	G>A	Pathogenic, likely-pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs1060502579	C>G,T	Pathogenic, likely-pathogenic	Splice donor variant
rs1555884790	->CG	Pathogenic, likely-pathogenic	Downstream transcript variant, frameshift variant, genic downstream transcript variant, coding sequence variant
rs1555889984	C>A	Pathogenic	Intron variant, non coding transcript variant, stop gained, coding sequence variant
rs1555899735	A>T	Uncertain-significance, likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1555899813	->CC	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1569001972	->AGCCGCCCACCATGGAGAACTGGTAGGAGCCGGCCGAGGCGCCGTAGTACAGGTGGTAGGAGGG	Likely-pathogenic	Downstream transcript variant, frameshift variant, genic downstream transcript variant, coding sequence variant
rs1569002077	->CCGA	Likely-pathogenic	Downstream transcript variant, frameshift variant, genic downstream transcript variant, coding sequence variant
rs1569002159	->GAGC	Likely-pathogenic	Downstream transcript variant, frameshift variant, genic downstream transcript variant, coding sequence variant
rs1569002296	G>T	Likely-pathogenic	Downstream transcript variant, stop gained, genic downstream transcript variant, coding sequence variant
rs1569002881	G>A	Likely-pathogenic	Stop gained, non coding transcript variant, genic downstream transcript variant, coding sequence variant
rs1569008655	G>A	Pathogenic, likely-pathogenic	Stop gained, non coding transcript variant, genic downstream transcript variant, coding sequence variant
rs1569009004	G>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, genic downstream transcript variant, coding sequence variant
rs1569037127	G>-	Likely-pathogenic	Intron variant, frameshift variant, non coding transcript variant, coding sequence variant
rs1569061762	C>T	Pathogenic, likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1569061768	G>A	Pathogenic, likely-pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs1569061786	T>A,G	Uncertain-significance, likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1569061831	G>C	Pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs1569084032	G>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1569084082	C>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1569084106	C>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1569084116	T>G	Uncertain-significance, likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1569084170	G>-	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1569084388	CC>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1569084451	CGCCGCTCCTCAGCTTGCCGGCCAGGGCAGCGCCGGCGTCCGGGGCGCCCAGC>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1569084530	->GGCGTCCGGGGCGCCCAGCGGCAACGCC	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1569084646	G>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1601333051	C>-	Likely-pathogenic	Downstream transcript variant, frameshift variant, genic downstream transcript variant, coding sequence variant
rs1601415426	G>A	Likely-pathogenic	Intron variant, non coding transcript variant, stop gained, coding sequence variant
rs1601470652	A>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1601528621	G>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1601528701	GAGCAGAGGAA>CAGCGGAAGGAG	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant

780

Show/Hide all (780)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003741	hsa-miR-17-5p	Luciferase reporter assay	17589498
MIRT003742	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRWestern blot	17589498
MIRT003743	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCRWestern blot	17589498
MIRT003741	hsa-miR-17-5p	Luciferase reporter assay	17589498
MIRT003742	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRWestern blot	17589498
MIRT003743	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCRWestern blot	17589498
MIRT003741	hsa-miR-17-5p	Reporter assayqRT-PCRWestern blot	17589498
MIRT038069	hsa-miR-423-5p	CLASH	23622248
MIRT053591	hsa-miR-675-5p	Luciferase reporter assayqRT-PCRWestern blot	24388988
MIRT053591	hsa-miR-675-5p	Luciferase reporter assayqRT-PCRWestern blot	24388988
MIRT438218	hsa-miR-221-3p	qRT-PCRWestern blot	24329418
MIRT438218	hsa-miR-221-3p	qRT-PCRWestern blot	24329418
MIRT699903	hsa-miR-3681-3p	HITS-CLIP	23313552
MIRT699902	hsa-miR-216a-3p	HITS-CLIP	23313552
MIRT000107	hsa-miR-27a-3p	HITS-CLIP	23313552
MIRT699901	hsa-miR-128-3p	HITS-CLIP	23313552
MIRT699900	hsa-miR-27b-3p	HITS-CLIP	23313552
MIRT534556	hsa-miR-551b-5p	HITS-CLIP	23313552
MIRT699899	hsa-miR-1179	HITS-CLIP	23313552
MIRT699898	hsa-miR-2115-3p	HITS-CLIP	23313552
MIRT699897	hsa-miR-141-5p	HITS-CLIP	23313552
MIRT699896	hsa-miR-4310	HITS-CLIP	23313552
MIRT699895	hsa-miR-7157-5p	HITS-CLIP	23313552
MIRT699894	hsa-miR-1470	HITS-CLIP	23313552
MIRT699893	hsa-miR-4667-3p	HITS-CLIP	23313552
MIRT699892	hsa-miR-1266-3p	HITS-CLIP	23313552
MIRT699891	hsa-miR-3160-5p	HITS-CLIP	23313552
MIRT699890	hsa-miR-513a-5p	HITS-CLIP	23313552
MIRT699889	hsa-miR-642a-5p	HITS-CLIP	23313552
MIRT699888	hsa-miR-4497	HITS-CLIP	23313552
MIRT699887	hsa-miR-4639-5p	HITS-CLIP	23313552
MIRT699886	hsa-miR-3180-5p	HITS-CLIP	23313552
MIRT699885	hsa-miR-4755-5p	HITS-CLIP	23313552
MIRT699884	hsa-miR-5006-3p	HITS-CLIP	23313552
MIRT699883	hsa-miR-7152-5p	HITS-CLIP	23313552
MIRT699882	hsa-miR-4446-5p	HITS-CLIP	23313552
MIRT699881	hsa-miR-6885-3p	HITS-CLIP	23313552
MIRT203374	hsa-miR-8485	HITS-CLIP	23313552
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT622382	hsa-miR-5096	HITS-CLIP	23824327
MIRT622381	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT622382	hsa-miR-5096	HITS-CLIP	23824327
MIRT622381	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT569545	hsa-miR-922	PAR-CLIP	20371350
MIRT569543	hsa-miR-4530	PAR-CLIP	20371350
MIRT569544	hsa-miR-3960	PAR-CLIP	20371350
MIRT569542	hsa-miR-8072	PAR-CLIP	20371350
MIRT569541	hsa-miR-6853-5p	PAR-CLIP	20371350
MIRT569540	hsa-miR-4467	PAR-CLIP	20371350
MIRT569539	hsa-miR-4417	PAR-CLIP	20371350
MIRT534556	hsa-miR-551b-5p	PAR-CLIP	22012620
MIRT534555	hsa-miR-605-5p	PAR-CLIP	22012620
MIRT534554	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT534553	hsa-miR-4308	PAR-CLIP	22012620
MIRT534552	hsa-miR-4292	PAR-CLIP	22012620
MIRT534551	hsa-miR-6791-5p	PAR-CLIP	22012620
MIRT534550	hsa-miR-3183	PAR-CLIP	22012620
MIRT534549	hsa-miR-4723-3p	PAR-CLIP	22012620
MIRT534548	hsa-miR-6769b-3p	PAR-CLIP	22012620
MIRT534547	hsa-miR-939-3p	PAR-CLIP	22012620
MIRT534546	hsa-miR-1285-3p	PAR-CLIP	22012620
MIRT534545	hsa-miR-3187-5p	PAR-CLIP	22012620
MIRT534544	hsa-miR-5189-5p	PAR-CLIP	22012620
MIRT534543	hsa-miR-612	PAR-CLIP	22012620
MIRT534542	hsa-miR-6860	PAR-CLIP	22012620
MIRT534541	hsa-miR-6721-5p	PAR-CLIP	22012620
MIRT534540	hsa-miR-4792	PAR-CLIP	22012620
MIRT534539	hsa-miR-7111-3p	PAR-CLIP	22012620
MIRT731126	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	25452107
MIRT731126	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	25452107
MIRT731126	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	25452107
MIRT699900	hsa-miR-27b-3p	Luciferase reporter assay	26870610
MIRT699900	hsa-miR-27b-3p	Luciferase reporter assay	26870610
MIRT732121	hsa-miR-215-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26716895
MIRT732121	hsa-miR-215-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26716895
MIRT053591	hsa-miR-675-5p	qRT-PCRWestern blot	26931432
MIRT755446	hsa-miR-181a-5p	Luciferase reporter assay	26580398
MIRT755446	hsa-miR-181a-5p	Luciferase reporter assay	26580398
MIRT755446	hsa-miR-181a-5p	Luciferase reporter assay	26580398
MIRT755446	hsa-miR-181a-5p	Luciferase reporter assay	26580398
MIRT755446	hsa-miR-181a-5p	Luciferase reporter assay	26580398
MIRT755446	hsa-miR-181a-5p	Luciferase reporter assay	26580398
MIRT622381	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT622381	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT622381	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT622381	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT622381	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT622383	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT622383	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT622383	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT622383	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT622383	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT622383	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT622382	hsa-miR-5096	HITS-CLIP	27418678
MIRT622382	hsa-miR-5096	HITS-CLIP	27418678
MIRT622382	hsa-miR-5096	HITS-CLIP	27418678
MIRT622382	hsa-miR-5096	HITS-CLIP	27418678
MIRT622382	hsa-miR-5096	HITS-CLIP	27418678
MIRT203374	hsa-miR-8485	HITS-CLIP	27418678
MIRT203374	hsa-miR-8485	HITS-CLIP	27418678
MIRT203374	hsa-miR-8485	HITS-CLIP	27418678
MIRT203374	hsa-miR-8485	HITS-CLIP	27418678
MIRT203374	hsa-miR-8485	HITS-CLIP	27418678
MIRT203374	hsa-miR-8485	HITS-CLIP	27418678
MIRT732904	hsa-miR-423-3p	ImmunofluorescenceRNA-seqqRT-PCRWestern blotting	33239422
MIRT734407	hsa-miR-188-3p	Luciferase reporter assayqRT-PCR	32671065
MIRT734851	hsa-miR-338-3p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCRFlow cytometry	32386260
MIRT732121	hsa-miR-215-5p	Luciferase reporter assayWestern blottingqRT-PCR	31498483
MIRT736382	hsa-miR-29b-1-5p	Western blottingqRT-PCR	33325145
MIRT736382	hsa-miR-29b-1-5p	Western blottingqRT-PCR	33325145
MIRT699901	hsa-miR-128-3p	qRT-PCR	33174052
MIRT699903	hsa-miR-3681-3p	HITS-CLIP	23313552
MIRT699902	hsa-miR-216a-3p	HITS-CLIP	23313552
MIRT000107	hsa-miR-27a-3p	HITS-CLIP	23313552
MIRT699901	hsa-miR-128-3p	HITS-CLIP	23313552
MIRT699900	hsa-miR-27b-3p	HITS-CLIP	23313552
MIRT534556	hsa-miR-551b-5p	HITS-CLIP	23313552
MIRT699899	hsa-miR-1179	HITS-CLIP	23313552
MIRT699898	hsa-miR-2115-3p	HITS-CLIP	23313552
MIRT699897	hsa-miR-141-5p	HITS-CLIP	23313552
MIRT699896	hsa-miR-4310	HITS-CLIP	23313552
MIRT699895	hsa-miR-7157-5p	HITS-CLIP	23313552
MIRT699894	hsa-miR-1470	HITS-CLIP	23313552
MIRT699893	hsa-miR-4667-3p	HITS-CLIP	23313552
MIRT699892	hsa-miR-1266-3p	HITS-CLIP	23313552
MIRT699891	hsa-miR-3160-5p	HITS-CLIP	23313552
MIRT699890	hsa-miR-513a-5p	HITS-CLIP	23313552
MIRT699889	hsa-miR-642a-5p	HITS-CLIP	23313552
MIRT699888	hsa-miR-4497	HITS-CLIP	23313552
MIRT699887	hsa-miR-4639-5p	HITS-CLIP	23313552
MIRT699886	hsa-miR-3180-5p	HITS-CLIP	23313552
MIRT699885	hsa-miR-4755-5p	HITS-CLIP	23313552
MIRT699884	hsa-miR-5006-3p	HITS-CLIP	23313552
MIRT699883	hsa-miR-7152-5p	HITS-CLIP	23313552
MIRT699882	hsa-miR-4446-5p	HITS-CLIP	23313552
MIRT699881	hsa-miR-6885-3p	HITS-CLIP	23313552
MIRT203374	hsa-miR-8485	HITS-CLIP	23313552
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT622382	hsa-miR-5096	HITS-CLIP	23824327
MIRT622381	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622383	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT622382	hsa-miR-5096	HITS-CLIP	23824327
MIRT622381	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT203374	hsa-miR-8485	HITS-CLIP	23824327
MIRT612533	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT569545	hsa-miR-922	PAR-CLIP	20371350
MIRT569543	hsa-miR-4530	PAR-CLIP	20371350
MIRT569544	hsa-miR-3960	PAR-CLIP	20371350
MIRT569542	hsa-miR-8072	PAR-CLIP	20371350
MIRT569541	hsa-miR-6853-5p	PAR-CLIP	20371350
MIRT569540	hsa-miR-4467	PAR-CLIP	20371350
MIRT569539	hsa-miR-4417	PAR-CLIP	20371350
MIRT534556	hsa-miR-551b-5p	PAR-CLIP	22012620
MIRT534555	hsa-miR-605-5p	PAR-CLIP	22012620
MIRT534554	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT534553	hsa-miR-4308	PAR-CLIP	22012620
MIRT534552	hsa-miR-4292	PAR-CLIP	22012620
MIRT534551	hsa-miR-6791-5p	PAR-CLIP	22012620
MIRT534550	hsa-miR-3183	PAR-CLIP	22012620
MIRT534549	hsa-miR-4723-3p	PAR-CLIP	22012620
MIRT534548	hsa-miR-6769b-3p	PAR-CLIP	22012620
MIRT534547	hsa-miR-939-3p	PAR-CLIP	22012620
MIRT534546	hsa-miR-1285-3p	PAR-CLIP	22012620
MIRT534545	hsa-miR-3187-5p	PAR-CLIP	22012620
MIRT534544	hsa-miR-5189-5p	PAR-CLIP	22012620
MIRT534543	hsa-miR-612	PAR-CLIP	22012620
MIRT534542	hsa-miR-6860	PAR-CLIP	22012620
MIRT534541	hsa-miR-6721-5p	PAR-CLIP	22012620
MIRT534540	hsa-miR-4792	PAR-CLIP	22012620
MIRT534539	hsa-miR-7111-3p	PAR-CLIP	22012620
MIRT755446	hsa-miR-181a-5p	Luciferase reporter assayWestern blottingqRT-PCR	36604945
MIRT1322733	hsa-miR-101	CLIP-seq
MIRT1322734	hsa-miR-1208	CLIP-seq
MIRT1322735	hsa-miR-1248	CLIP-seq
MIRT1322736	hsa-miR-1251	CLIP-seq
MIRT1322737	hsa-miR-1263	CLIP-seq
MIRT1322738	hsa-miR-1279	CLIP-seq
MIRT1322739	hsa-miR-128	CLIP-seq
MIRT1322740	hsa-miR-1293	CLIP-seq
MIRT1322741	hsa-miR-135a	CLIP-seq
MIRT1322742	hsa-miR-135b	CLIP-seq
MIRT1322743	hsa-miR-139-5p	CLIP-seq
MIRT1322744	hsa-miR-141	CLIP-seq
MIRT1322745	hsa-miR-144	CLIP-seq
MIRT1322746	hsa-miR-15a	CLIP-seq
MIRT1322747	hsa-miR-15b	CLIP-seq
MIRT1322748	hsa-miR-16	CLIP-seq
MIRT1322749	hsa-miR-195	CLIP-seq
MIRT1322750	hsa-miR-200a	CLIP-seq
MIRT1322751	hsa-miR-203	CLIP-seq
MIRT1322752	hsa-miR-224	CLIP-seq
MIRT1322753	hsa-miR-27a	CLIP-seq
MIRT1322754	hsa-miR-27b	CLIP-seq
MIRT1322755	hsa-miR-3121-3p	CLIP-seq
MIRT1322756	hsa-miR-3124-3p	CLIP-seq
MIRT1322757	hsa-miR-3130-3p	CLIP-seq
MIRT1322758	hsa-miR-3140-3p	CLIP-seq
MIRT1322759	hsa-miR-3162-3p	CLIP-seq
MIRT1322760	hsa-miR-3163	CLIP-seq
MIRT1322761	hsa-miR-330-3p	CLIP-seq
MIRT1322762	hsa-miR-331-3p	CLIP-seq
MIRT1322763	hsa-miR-3609	CLIP-seq
MIRT1322764	hsa-miR-3613-3p	CLIP-seq
MIRT1322765	hsa-miR-3653	CLIP-seq
MIRT1322766	hsa-miR-3654	CLIP-seq
MIRT1322767	hsa-miR-3682-5p	CLIP-seq
MIRT1322768	hsa-miR-3714	CLIP-seq
MIRT1322769	hsa-miR-377	CLIP-seq
MIRT1322770	hsa-miR-3907	CLIP-seq
MIRT1322771	hsa-miR-3942-3p	CLIP-seq
MIRT1322772	hsa-miR-424	CLIP-seq
MIRT1322773	hsa-miR-4272	CLIP-seq
MIRT1322774	hsa-miR-4299	CLIP-seq
MIRT1322775	hsa-miR-4436a	CLIP-seq
MIRT1322776	hsa-miR-4447	CLIP-seq
MIRT1322777	hsa-miR-4468	CLIP-seq
MIRT1322778	hsa-miR-4472	CLIP-seq
MIRT1322779	hsa-miR-4483	CLIP-seq
MIRT1322780	hsa-miR-4511	CLIP-seq
MIRT1322781	hsa-miR-451b	CLIP-seq
MIRT1322782	hsa-miR-4535	CLIP-seq
MIRT1322783	hsa-miR-4539	CLIP-seq
MIRT1322784	hsa-miR-4658	CLIP-seq
MIRT1322785	hsa-miR-4668-3p	CLIP-seq
MIRT1322786	hsa-miR-4684-5p	CLIP-seq
MIRT1322787	hsa-miR-4686	CLIP-seq
MIRT1322788	hsa-miR-4699-3p	CLIP-seq
MIRT1322789	hsa-miR-4700-3p	CLIP-seq
MIRT1322790	hsa-miR-4716-5p	CLIP-seq
MIRT1322791	hsa-miR-4738-5p	CLIP-seq
MIRT1322792	hsa-miR-4758-5p	CLIP-seq
MIRT1322793	hsa-miR-4765	CLIP-seq
MIRT1322794	hsa-miR-4766-3p	CLIP-seq
MIRT1322795	hsa-miR-4766-5p	CLIP-seq
MIRT1322796	hsa-miR-4777-5p	CLIP-seq
MIRT1322797	hsa-miR-4786-5p	CLIP-seq
MIRT1322798	hsa-miR-4793-3p	CLIP-seq
MIRT1322799	hsa-miR-492	CLIP-seq
MIRT1322800	hsa-miR-497	CLIP-seq
MIRT1322801	hsa-miR-513a-3p	CLIP-seq
MIRT1322802	hsa-miR-520d-5p	CLIP-seq
MIRT1322803	hsa-miR-524-5p	CLIP-seq
MIRT1322804	hsa-miR-548ah	CLIP-seq
MIRT1322805	hsa-miR-548b-3p	CLIP-seq
MIRT1322806	hsa-miR-548c-3p	CLIP-seq
MIRT1322807	hsa-miR-548p	CLIP-seq
MIRT1322808	hsa-miR-548t	CLIP-seq
MIRT1322809	hsa-miR-562	CLIP-seq
MIRT1322810	hsa-miR-577	CLIP-seq
MIRT1322811	hsa-miR-578	CLIP-seq
MIRT1322812	hsa-miR-581	CLIP-seq
MIRT1322813	hsa-miR-587	CLIP-seq
MIRT1322814	hsa-miR-642a	CLIP-seq
MIRT1322815	hsa-miR-653	CLIP-seq
MIRT1322816	hsa-miR-654-3p	CLIP-seq
MIRT1322817	hsa-miR-769-5p	CLIP-seq
MIRT1322818	hsa-miR-936	CLIP-seq
MIRT1322819	hsa-miR-942	CLIP-seq
MIRT1322736	hsa-miR-1251	CLIP-seq
MIRT1322820	hsa-miR-1261	CLIP-seq
MIRT1322821	hsa-miR-1285	CLIP-seq
MIRT1322822	hsa-miR-1299	CLIP-seq
MIRT1322823	hsa-miR-199a-3p	CLIP-seq
MIRT1322824	hsa-miR-199b-3p	CLIP-seq
MIRT1322825	hsa-miR-219-1-3p	CLIP-seq
MIRT1322826	hsa-miR-219-2-3p	CLIP-seq
MIRT1322752	hsa-miR-224	CLIP-seq
MIRT1322753	hsa-miR-27a	CLIP-seq
MIRT1322754	hsa-miR-27b	CLIP-seq
MIRT1322827	hsa-miR-2964a-3p	CLIP-seq
MIRT1322828	hsa-miR-30a	CLIP-seq
MIRT1322829	hsa-miR-30b	CLIP-seq
MIRT1322830	hsa-miR-30c	CLIP-seq
MIRT1322831	hsa-miR-30d	CLIP-seq
MIRT1322832	hsa-miR-30e	CLIP-seq
MIRT1322833	hsa-miR-3129-5p	CLIP-seq
MIRT1322758	hsa-miR-3140-3p	CLIP-seq
MIRT1322760	hsa-miR-3163	CLIP-seq
MIRT1322834	hsa-miR-3173-3p	CLIP-seq
MIRT1322835	hsa-miR-324-5p	CLIP-seq
MIRT1322763	hsa-miR-3609	CLIP-seq
MIRT1322764	hsa-miR-3613-3p	CLIP-seq
MIRT1322836	hsa-miR-3616-3p	CLIP-seq
MIRT1322837	hsa-miR-3646	CLIP-seq
MIRT1322838	hsa-miR-3662	CLIP-seq
MIRT1322839	hsa-miR-3679-3p	CLIP-seq
MIRT1322767	hsa-miR-3682-5p	CLIP-seq
MIRT1322770	hsa-miR-3907	CLIP-seq
MIRT1322771	hsa-miR-3942-3p	CLIP-seq
MIRT1322840	hsa-miR-4421	CLIP-seq
MIRT1322841	hsa-miR-4428	CLIP-seq
MIRT1322842	hsa-miR-4452	CLIP-seq
MIRT1322843	hsa-miR-4477b	CLIP-seq
MIRT1322844	hsa-miR-4495	CLIP-seq
MIRT1322780	hsa-miR-4511	CLIP-seq
MIRT1322845	hsa-miR-4645-3p	CLIP-seq
MIRT1322846	hsa-miR-4649-5p	CLIP-seq
MIRT1322785	hsa-miR-4668-3p	CLIP-seq
MIRT1322847	hsa-miR-4670-3p	CLIP-seq
MIRT1322786	hsa-miR-4684-5p	CLIP-seq
MIRT1322848	hsa-miR-4712-3p	CLIP-seq
MIRT1322849	hsa-miR-4721	CLIP-seq
MIRT1322850	hsa-miR-4752	CLIP-seq
MIRT1322851	hsa-miR-4773	CLIP-seq
MIRT1322796	hsa-miR-4777-5p	CLIP-seq
MIRT1322852	hsa-miR-4782-5p	CLIP-seq
MIRT1322853	hsa-miR-488	CLIP-seq
MIRT1322801	hsa-miR-513a-3p	CLIP-seq
MIRT1322854	hsa-miR-516b	CLIP-seq
MIRT1322855	hsa-miR-544b	CLIP-seq
MIRT1322804	hsa-miR-548ah	CLIP-seq
MIRT1322805	hsa-miR-548b-3p	CLIP-seq
MIRT1322808	hsa-miR-548t	CLIP-seq
MIRT1322856	hsa-miR-571	CLIP-seq
MIRT1322810	hsa-miR-577	CLIP-seq
MIRT1322819	hsa-miR-942	CLIP-seq
MIRT1322821	hsa-miR-1285	CLIP-seq
MIRT1553210	hsa-miR-410	CLIP-seq
MIRT1553211	hsa-miR-605	CLIP-seq
MIRT2095748	hsa-miR-106a	CLIP-seq
MIRT2095749	hsa-miR-106b	CLIP-seq
MIRT2095750	hsa-miR-1182	CLIP-seq
MIRT2095751	hsa-miR-1245b-3p	CLIP-seq
MIRT1322735	hsa-miR-1248	CLIP-seq
MIRT1322739	hsa-miR-128	CLIP-seq
MIRT1322821	hsa-miR-1285	CLIP-seq
MIRT2095752	hsa-miR-129-5p	CLIP-seq
MIRT1322822	hsa-miR-1299	CLIP-seq
MIRT1322741	hsa-miR-135a	CLIP-seq
MIRT1322742	hsa-miR-135b	CLIP-seq
MIRT2095753	hsa-miR-138	CLIP-seq
MIRT2095754	hsa-miR-149	CLIP-seq
MIRT2095755	hsa-miR-17	CLIP-seq
MIRT2095756	hsa-miR-192	CLIP-seq
MIRT1322823	hsa-miR-199a-3p	CLIP-seq
MIRT1322824	hsa-miR-199b-3p	CLIP-seq
MIRT2095757	hsa-miR-20a	CLIP-seq
MIRT2095758	hsa-miR-20b	CLIP-seq
MIRT2095759	hsa-miR-215	CLIP-seq
MIRT2095760	hsa-miR-217	CLIP-seq
MIRT1322752	hsa-miR-224	CLIP-seq
MIRT1322753	hsa-miR-27a	CLIP-seq
MIRT1322754	hsa-miR-27b	CLIP-seq
MIRT2095761	hsa-miR-296-5p	CLIP-seq
MIRT2095762	hsa-miR-302a	CLIP-seq
MIRT2095763	hsa-miR-302b	CLIP-seq
MIRT2095764	hsa-miR-302c	CLIP-seq
MIRT2095765	hsa-miR-302d	CLIP-seq
MIRT2095766	hsa-miR-302e	CLIP-seq
MIRT2095767	hsa-miR-3064-5p	CLIP-seq
MIRT2095768	hsa-miR-3120-3p	CLIP-seq
MIRT1322755	hsa-miR-3121-3p	CLIP-seq
MIRT1322756	hsa-miR-3124-3p	CLIP-seq
MIRT2095769	hsa-miR-3126-3p	CLIP-seq
MIRT1322833	hsa-miR-3129-5p	CLIP-seq
MIRT2095770	hsa-miR-3148	CLIP-seq
MIRT1322760	hsa-miR-3163	CLIP-seq
MIRT2095771	hsa-miR-3170	CLIP-seq
MIRT2095772	hsa-miR-3179	CLIP-seq
MIRT2095773	hsa-miR-3189-3p	CLIP-seq
MIRT2095774	hsa-miR-3192	CLIP-seq
MIRT2095775	hsa-miR-323b-3p	CLIP-seq
MIRT1322835	hsa-miR-324-5p	CLIP-seq
MIRT1322761	hsa-miR-330-3p	CLIP-seq
MIRT2095776	hsa-miR-338-5p	CLIP-seq
MIRT2095777	hsa-miR-342-5p	CLIP-seq
MIRT2095778	hsa-miR-3611	CLIP-seq
MIRT2095779	hsa-miR-361-5p	CLIP-seq
MIRT1322836	hsa-miR-3616-3p	CLIP-seq
MIRT2095780	hsa-miR-3647-3p	CLIP-seq
MIRT1322765	hsa-miR-3653	CLIP-seq
MIRT1322766	hsa-miR-3654	CLIP-seq
MIRT2095781	hsa-miR-3658	CLIP-seq
MIRT1322767	hsa-miR-3682-5p	CLIP-seq
MIRT2095782	hsa-miR-372	CLIP-seq
MIRT2095783	hsa-miR-373	CLIP-seq
MIRT1322769	hsa-miR-377	CLIP-seq
MIRT2095784	hsa-miR-4271	CLIP-seq
MIRT1322773	hsa-miR-4272	CLIP-seq
MIRT1322774	hsa-miR-4299	CLIP-seq
MIRT2095785	hsa-miR-4314	CLIP-seq
MIRT2095786	hsa-miR-4418	CLIP-seq
MIRT2095787	hsa-miR-4456	CLIP-seq
MIRT2095788	hsa-miR-4501	CLIP-seq
MIRT2095789	hsa-miR-450b-5p	CLIP-seq
MIRT1322780	hsa-miR-4511	CLIP-seq
MIRT1322781	hsa-miR-451b	CLIP-seq
MIRT2095790	hsa-miR-4520a-3p	CLIP-seq
MIRT2095791	hsa-miR-4520b-3p	CLIP-seq
MIRT2095792	hsa-miR-4529-3p	CLIP-seq
MIRT2095793	hsa-miR-4646-5p	CLIP-seq
MIRT1322846	hsa-miR-4649-5p	CLIP-seq
MIRT2095794	hsa-miR-4651	CLIP-seq
MIRT1322784	hsa-miR-4658	CLIP-seq
MIRT2095795	hsa-miR-4664-5p	CLIP-seq
MIRT1322785	hsa-miR-4668-3p	CLIP-seq
MIRT1322788	hsa-miR-4699-3p	CLIP-seq
MIRT2095796	hsa-miR-4716-3p	CLIP-seq
MIRT1322790	hsa-miR-4716-5p	CLIP-seq
MIRT2095797	hsa-miR-4719	CLIP-seq
MIRT1322849	hsa-miR-4721	CLIP-seq
MIRT2095798	hsa-miR-4725-3p	CLIP-seq
MIRT1322792	hsa-miR-4758-5p	CLIP-seq
MIRT1322793	hsa-miR-4765	CLIP-seq
MIRT2095799	hsa-miR-4768-5p	CLIP-seq
MIRT1322852	hsa-miR-4782-5p	CLIP-seq
MIRT2095800	hsa-miR-4794	CLIP-seq
MIRT2095801	hsa-miR-507	CLIP-seq
MIRT2095802	hsa-miR-509-3-5p	CLIP-seq
MIRT2095803	hsa-miR-509-5p	CLIP-seq
MIRT1322854	hsa-miR-516b	CLIP-seq
MIRT2095804	hsa-miR-519d	CLIP-seq
MIRT2095805	hsa-miR-520a-3p	CLIP-seq
MIRT2095806	hsa-miR-520b	CLIP-seq
MIRT2095807	hsa-miR-520c-3p	CLIP-seq
MIRT2095808	hsa-miR-520d-3p	CLIP-seq
MIRT2095809	hsa-miR-520e	CLIP-seq
MIRT2095810	hsa-miR-520g	CLIP-seq
MIRT2095811	hsa-miR-520h	CLIP-seq
MIRT2095812	hsa-miR-541	CLIP-seq
MIRT2095813	hsa-miR-548q	CLIP-seq
MIRT2095814	hsa-miR-557	CLIP-seq
MIRT2095815	hsa-miR-561	CLIP-seq
MIRT2095816	hsa-miR-579	CLIP-seq
MIRT2095817	hsa-miR-584	CLIP-seq
MIRT1322813	hsa-miR-587	CLIP-seq
MIRT1553211	hsa-miR-605	CLIP-seq
MIRT2095818	hsa-miR-608	CLIP-seq
MIRT2095819	hsa-miR-625	CLIP-seq
MIRT1322814	hsa-miR-642a	CLIP-seq
MIRT1322815	hsa-miR-653	CLIP-seq
MIRT2095820	hsa-miR-654-5p	CLIP-seq
MIRT2095821	hsa-miR-875-3p	CLIP-seq
MIRT2095822	hsa-miR-93	CLIP-seq
MIRT2095823	hsa-miR-938	CLIP-seq
MIRT2095750	hsa-miR-1182	CLIP-seq
MIRT1322820	hsa-miR-1261	CLIP-seq
MIRT1322739	hsa-miR-128	CLIP-seq
MIRT1322821	hsa-miR-1285	CLIP-seq
MIRT2095752	hsa-miR-129-5p	CLIP-seq
MIRT1322822	hsa-miR-1299	CLIP-seq
MIRT2320192	hsa-miR-1324	CLIP-seq
MIRT1322744	hsa-miR-141	CLIP-seq
MIRT2320193	hsa-miR-146b-3p	CLIP-seq
MIRT2320194	hsa-miR-181a	CLIP-seq
MIRT2320195	hsa-miR-181b	CLIP-seq
MIRT2320196	hsa-miR-181c	CLIP-seq
MIRT2320197	hsa-miR-181d	CLIP-seq
MIRT2095756	hsa-miR-192	CLIP-seq
MIRT1322823	hsa-miR-199a-3p	CLIP-seq
MIRT1322824	hsa-miR-199b-3p	CLIP-seq
MIRT1322750	hsa-miR-200a	CLIP-seq
MIRT2320198	hsa-miR-200b	CLIP-seq
MIRT2320199	hsa-miR-200c	CLIP-seq
MIRT2095759	hsa-miR-215	CLIP-seq
MIRT1322825	hsa-miR-219-1-3p	CLIP-seq
MIRT2320200	hsa-miR-22	CLIP-seq
MIRT1322752	hsa-miR-224	CLIP-seq
MIRT2320201	hsa-miR-2276	CLIP-seq
MIRT2320202	hsa-miR-23a	CLIP-seq
MIRT2320203	hsa-miR-23b	CLIP-seq
MIRT2320204	hsa-miR-23c	CLIP-seq
MIRT1322753	hsa-miR-27a	CLIP-seq
MIRT1322754	hsa-miR-27b	CLIP-seq
MIRT2320205	hsa-miR-3065-5p	CLIP-seq
MIRT1322828	hsa-miR-30a	CLIP-seq
MIRT1322829	hsa-miR-30b	CLIP-seq
MIRT1322830	hsa-miR-30c	CLIP-seq
MIRT1322831	hsa-miR-30d	CLIP-seq
MIRT1322832	hsa-miR-30e	CLIP-seq
MIRT1322755	hsa-miR-3121-3p	CLIP-seq
MIRT1322833	hsa-miR-3129-5p	CLIP-seq
MIRT2320206	hsa-miR-3155	CLIP-seq
MIRT2320207	hsa-miR-3155b	CLIP-seq
MIRT1322760	hsa-miR-3163	CLIP-seq
MIRT2320208	hsa-miR-3173-5p	CLIP-seq
MIRT2320209	hsa-miR-3182	CLIP-seq
MIRT2320210	hsa-miR-3202	CLIP-seq
MIRT2320211	hsa-miR-323-3p	CLIP-seq
MIRT2320212	hsa-miR-3661	CLIP-seq
MIRT1322838	hsa-miR-3662	CLIP-seq
MIRT2320213	hsa-miR-3665	CLIP-seq
MIRT1322767	hsa-miR-3682-5p	CLIP-seq
MIRT1322768	hsa-miR-3714	CLIP-seq
MIRT1322769	hsa-miR-377	CLIP-seq
MIRT2320214	hsa-miR-3922-5p	CLIP-seq
MIRT2320215	hsa-miR-4262	CLIP-seq
MIRT2320216	hsa-miR-4263	CLIP-seq
MIRT2320217	hsa-miR-4267	CLIP-seq
MIRT2320218	hsa-miR-429	CLIP-seq
MIRT2320219	hsa-miR-4419a	CLIP-seq
MIRT2320220	hsa-miR-4459	CLIP-seq
MIRT1322844	hsa-miR-4495	CLIP-seq
MIRT2320221	hsa-miR-4505	CLIP-seq
MIRT2095789	hsa-miR-450b-5p	CLIP-seq
MIRT2320222	hsa-miR-4510	CLIP-seq
MIRT2095790	hsa-miR-4520a-3p	CLIP-seq
MIRT2320223	hsa-miR-4533	CLIP-seq
MIRT1322783	hsa-miR-4539	CLIP-seq
MIRT2320224	hsa-miR-4643	CLIP-seq
MIRT2320225	hsa-miR-4652-3p	CLIP-seq
MIRT1322785	hsa-miR-4668-3p	CLIP-seq
MIRT2320226	hsa-miR-4695-5p	CLIP-seq
MIRT2095797	hsa-miR-4719	CLIP-seq
MIRT739033	hsa-miR-4720-3p	CLIP-seq
MIRT1322791	hsa-miR-4738-5p	CLIP-seq
MIRT2320227	hsa-miR-4763-5p	CLIP-seq
MIRT2320228	hsa-miR-4772-3p	CLIP-seq
MIRT1322852	hsa-miR-4782-5p	CLIP-seq
MIRT2095800	hsa-miR-4794	CLIP-seq
MIRT2320229	hsa-miR-4796-3p	CLIP-seq
MIRT2320230	hsa-miR-484	CLIP-seq
MIRT2320231	hsa-miR-498	CLIP-seq
MIRT2095801	hsa-miR-507	CLIP-seq
MIRT2320232	hsa-miR-509-3p	CLIP-seq
MIRT1322854	hsa-miR-516b	CLIP-seq
MIRT2320233	hsa-miR-548aa	CLIP-seq
MIRT2320234	hsa-miR-548ac	CLIP-seq
MIRT2320235	hsa-miR-548ae	CLIP-seq
MIRT2320236	hsa-miR-548aj	CLIP-seq
MIRT2320237	hsa-miR-548am	CLIP-seq
MIRT1322806	hsa-miR-548c-3p	CLIP-seq
MIRT2320238	hsa-miR-548d-3p	CLIP-seq
MIRT2095813	hsa-miR-548q	CLIP-seq
MIRT2320239	hsa-miR-548x	CLIP-seq
MIRT2320240	hsa-miR-548z	CLIP-seq
MIRT2095814	hsa-miR-557	CLIP-seq
MIRT2320241	hsa-miR-576-5p	CLIP-seq
MIRT2095816	hsa-miR-579	CLIP-seq
MIRT1322813	hsa-miR-587	CLIP-seq
MIRT2320242	hsa-miR-631	CLIP-seq
MIRT1322814	hsa-miR-642a	CLIP-seq
MIRT1322815	hsa-miR-653	CLIP-seq
MIRT2320243	hsa-miR-657	CLIP-seq
MIRT2320244	hsa-miR-664	CLIP-seq
MIRT2320245	hsa-miR-767-3p	CLIP-seq
MIRT2320246	hsa-miR-874	CLIP-seq
MIRT2095821	hsa-miR-875-3p	CLIP-seq
MIRT2320247	hsa-miR-891b	CLIP-seq
MIRT1322739	hsa-miR-128	CLIP-seq
MIRT1322753	hsa-miR-27a	CLIP-seq
MIRT1322754	hsa-miR-27b	CLIP-seq
MIRT1322835	hsa-miR-324-5p	CLIP-seq
MIRT1322769	hsa-miR-377	CLIP-seq
MIRT2320224	hsa-miR-4643	CLIP-seq
MIRT2320225	hsa-miR-4652-3p	CLIP-seq
MIRT2095816	hsa-miR-579	CLIP-seq
MIRT1322814	hsa-miR-642a	CLIP-seq
MIRT1322733	hsa-miR-101	CLIP-seq
MIRT2095748	hsa-miR-106a	CLIP-seq
MIRT2095749	hsa-miR-106b	CLIP-seq
MIRT2432851	hsa-miR-1244	CLIP-seq
MIRT2432852	hsa-miR-127-5p	CLIP-seq
MIRT1322739	hsa-miR-128	CLIP-seq
MIRT1322741	hsa-miR-135a	CLIP-seq
MIRT1322742	hsa-miR-135b	CLIP-seq
MIRT1322745	hsa-miR-144	CLIP-seq
MIRT2095755	hsa-miR-17	CLIP-seq
MIRT2432853	hsa-miR-1825	CLIP-seq
MIRT1322823	hsa-miR-199a-3p	CLIP-seq
MIRT2432854	hsa-miR-199a-5p	CLIP-seq
MIRT1322824	hsa-miR-199b-3p	CLIP-seq
MIRT2432855	hsa-miR-199b-5p	CLIP-seq
MIRT2095757	hsa-miR-20a	CLIP-seq
MIRT2095758	hsa-miR-20b	CLIP-seq
MIRT2095760	hsa-miR-217	CLIP-seq
MIRT1322753	hsa-miR-27a	CLIP-seq
MIRT1322754	hsa-miR-27b	CLIP-seq
MIRT2095762	hsa-miR-302a	CLIP-seq
MIRT2095763	hsa-miR-302b	CLIP-seq
MIRT2095764	hsa-miR-302c	CLIP-seq
MIRT2095765	hsa-miR-302d	CLIP-seq
MIRT2095766	hsa-miR-302e	CLIP-seq
MIRT2432856	hsa-miR-3119	CLIP-seq
MIRT2095769	hsa-miR-3126-3p	CLIP-seq
MIRT1322833	hsa-miR-3129-5p	CLIP-seq
MIRT1322760	hsa-miR-3163	CLIP-seq
MIRT2432857	hsa-miR-320e	CLIP-seq
MIRT2095776	hsa-miR-338-5p	CLIP-seq
MIRT1322837	hsa-miR-3646	CLIP-seq
MIRT2432858	hsa-miR-371-3p	CLIP-seq
MIRT2432859	hsa-miR-371b-3p	CLIP-seq
MIRT2095782	hsa-miR-372	CLIP-seq
MIRT2095783	hsa-miR-373	CLIP-seq
MIRT2432860	hsa-miR-374a	CLIP-seq
MIRT2432861	hsa-miR-374b	CLIP-seq
MIRT2432862	hsa-miR-3943	CLIP-seq
MIRT2432863	hsa-miR-4265	CLIP-seq
MIRT2432864	hsa-miR-4282	CLIP-seq
MIRT2432865	hsa-miR-4296	CLIP-seq
MIRT2432866	hsa-miR-4302	CLIP-seq
MIRT2432867	hsa-miR-4313	CLIP-seq
MIRT2432868	hsa-miR-4322	CLIP-seq
MIRT2432869	hsa-miR-4450	CLIP-seq
MIRT2432870	hsa-miR-4504	CLIP-seq
MIRT1322783	hsa-miR-4539	CLIP-seq
MIRT2320224	hsa-miR-4643	CLIP-seq
MIRT2432871	hsa-miR-4648	CLIP-seq
MIRT2432872	hsa-miR-4654	CLIP-seq
MIRT2432873	hsa-miR-4667-5p	CLIP-seq
MIRT1322785	hsa-miR-4668-3p	CLIP-seq
MIRT1322788	hsa-miR-4699-3p	CLIP-seq
MIRT2432874	hsa-miR-4700-5p	CLIP-seq
MIRT2432875	hsa-miR-4717-3p	CLIP-seq
MIRT2432876	hsa-miR-4725-5p	CLIP-seq
MIRT2432877	hsa-miR-4764-3p	CLIP-seq
MIRT2432878	hsa-miR-4769-5p	CLIP-seq
MIRT2432879	hsa-miR-4803	CLIP-seq
MIRT2432880	hsa-miR-502-5p	CLIP-seq
MIRT2432881	hsa-miR-504	CLIP-seq
MIRT2432882	hsa-miR-515-3p	CLIP-seq
MIRT2095804	hsa-miR-519d	CLIP-seq
MIRT2432883	hsa-miR-519e	CLIP-seq
MIRT2095805	hsa-miR-520a-3p	CLIP-seq
MIRT2095806	hsa-miR-520b	CLIP-seq
MIRT2095807	hsa-miR-520c-3p	CLIP-seq
MIRT2095808	hsa-miR-520d-3p	CLIP-seq
MIRT2095809	hsa-miR-520e	CLIP-seq
MIRT2095810	hsa-miR-520g	CLIP-seq
MIRT2095811	hsa-miR-520h	CLIP-seq
MIRT1322806	hsa-miR-548c-3p	CLIP-seq
MIRT2432884	hsa-miR-549	CLIP-seq
MIRT2432885	hsa-miR-618	CLIP-seq
MIRT2432886	hsa-miR-637	CLIP-seq
MIRT1322814	hsa-miR-642a	CLIP-seq
MIRT2095822	hsa-miR-93	CLIP-seq
MIRT1322739	hsa-miR-128	CLIP-seq
MIRT2095752	hsa-miR-129-5p	CLIP-seq
MIRT2320194	hsa-miR-181a	CLIP-seq
MIRT2320195	hsa-miR-181b	CLIP-seq
MIRT2320196	hsa-miR-181c	CLIP-seq
MIRT2320197	hsa-miR-181d	CLIP-seq
MIRT1322753	hsa-miR-27a	CLIP-seq
MIRT1322754	hsa-miR-27b	CLIP-seq
MIRT1322760	hsa-miR-3163	CLIP-seq
MIRT1322762	hsa-miR-331-3p	CLIP-seq
MIRT1322839	hsa-miR-3679-3p	CLIP-seq
MIRT2320215	hsa-miR-4262	CLIP-seq
MIRT2440001	hsa-miR-4277	CLIP-seq
MIRT2095789	hsa-miR-450b-5p	CLIP-seq
MIRT1322785	hsa-miR-4668-3p	CLIP-seq
MIRT2440002	hsa-miR-4709-5p	CLIP-seq
MIRT2095797	hsa-miR-4719	CLIP-seq
MIRT2440003	hsa-miR-4731-5p	CLIP-seq
MIRT1322791	hsa-miR-4738-5p	CLIP-seq
MIRT1322851	hsa-miR-4773	CLIP-seq
MIRT2095801	hsa-miR-507	CLIP-seq
MIRT2095814	hsa-miR-557	CLIP-seq
MIRT2095816	hsa-miR-579	CLIP-seq
MIRT1322814	hsa-miR-642a	CLIP-seq
MIRT2320244	hsa-miR-664	CLIP-seq
MIRT2095750	hsa-miR-1182	CLIP-seq
MIRT1322746	hsa-miR-15a	CLIP-seq
MIRT1322747	hsa-miR-15b	CLIP-seq
MIRT1322748	hsa-miR-16	CLIP-seq
MIRT1322749	hsa-miR-195	CLIP-seq
MIRT1322823	hsa-miR-199a-3p	CLIP-seq
MIRT1322824	hsa-miR-199b-3p	CLIP-seq
MIRT2320200	hsa-miR-22	CLIP-seq
MIRT2616055	hsa-miR-3064-3p	CLIP-seq
MIRT1322755	hsa-miR-3121-3p	CLIP-seq
MIRT1322833	hsa-miR-3129-5p	CLIP-seq
MIRT1322758	hsa-miR-3140-3p	CLIP-seq
MIRT2616056	hsa-miR-3144-3p	CLIP-seq
MIRT2616057	hsa-miR-3152-3p	CLIP-seq
MIRT1322772	hsa-miR-424	CLIP-seq
MIRT1322774	hsa-miR-4299	CLIP-seq
MIRT1322776	hsa-miR-4447	CLIP-seq
MIRT1322777	hsa-miR-4468	CLIP-seq
MIRT1322778	hsa-miR-4472	CLIP-seq
MIRT2616058	hsa-miR-4488	CLIP-seq
MIRT2616059	hsa-miR-4492	CLIP-seq
MIRT2616060	hsa-miR-4498	CLIP-seq
MIRT1322784	hsa-miR-4658	CLIP-seq
MIRT2616061	hsa-miR-4697-5p	CLIP-seq
MIRT2095797	hsa-miR-4719	CLIP-seq
MIRT1322792	hsa-miR-4758-5p	CLIP-seq
MIRT1322793	hsa-miR-4765	CLIP-seq
MIRT1322800	hsa-miR-497	CLIP-seq
MIRT2095813	hsa-miR-548q	CLIP-seq
MIRT2616062	hsa-miR-576-3p	CLIP-seq
MIRT2095817	hsa-miR-584	CLIP-seq
MIRT1322815	hsa-miR-653	CLIP-seq
MIRT2616063	hsa-miR-762	CLIP-seq
MIRT1322818	hsa-miR-936	CLIP-seq
MIRT1322738	hsa-miR-1279	CLIP-seq
MIRT2616055	hsa-miR-3064-3p	CLIP-seq
MIRT1322755	hsa-miR-3121-3p	CLIP-seq
MIRT1322756	hsa-miR-3124-3p	CLIP-seq
MIRT1322761	hsa-miR-330-3p	CLIP-seq
MIRT1322776	hsa-miR-4447	CLIP-seq
MIRT1322778	hsa-miR-4472	CLIP-seq
MIRT2616058	hsa-miR-4488	CLIP-seq
MIRT2616059	hsa-miR-4492	CLIP-seq
MIRT2616060	hsa-miR-4498	CLIP-seq
MIRT2616061	hsa-miR-4697-5p	CLIP-seq
MIRT2095797	hsa-miR-4719	CLIP-seq
MIRT2095815	hsa-miR-561	CLIP-seq
MIRT1322813	hsa-miR-587	CLIP-seq
MIRT2616063	hsa-miR-762	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
CBFB	Unknown	24648201
GATA1	Unknown	16628190
HLF	Repression	11486032
L3MBTL1	Repression	18474616
PITX1	Repression	21425961
RUNX3	Repression	19403666
RUNX3	Unknown	15688019
TLE3	Repression	19403666
TOP2B	Activation	24327541

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	21873977
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	9199349
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	9199349
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	17377532
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001222	Function	Transcription corepressor binding	IPI	9751710
GO:0001223	Function	Transcription coactivator binding	IPI	11742995
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9199349
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	9199349
GO:0001503	Process	Ossification	IBA
GO:0002062	Process	Chondrocyte differentiation	IBA
GO:0002573	Process	Myeloid leukocyte differentiation	IMP	28111278
GO:0003677	Function	DNA binding	IDA	8413232, 9199349, 12217689
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9199349, 14970218
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	12217689
GO:0005515	Function	Protein binding	IPI	2845103, 9751710, 10207087, 10856244, 11965546, 12217689, 14970218, 16917507, 17377532, 17431401, 18280240, 19497860, 21179004, 21873977, 22253733, 25241761, 25283809, 25678665, 28533407, 29391048, 32296183, 33961781, 34591612, 35914814
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	7862156
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9199349
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0010755	Process	Regulation of plasminogen activation	ISS
GO:0016513	Component	Core-binding factor complex	IEA
GO:0016513	Component	Core-binding factor complex	TAS	18258917
GO:0030097	Process	Hemopoiesis	IBA
GO:0030097	Process	Hemopoiesis	IDA	21873977
GO:0030097	Process	Hemopoiesis	TAS	12217689
GO:0030099	Process	Myeloid cell differentiation	IDA	11742995
GO:0030182	Process	Neuron differentiation	IBA
GO:0030853	Process	Negative regulation of granulocyte differentiation	IMP	9199349
GO:0030854	Process	Positive regulation of granulocyte differentiation	IMP	9199349
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	17377532
GO:0032967	Process	Positive regulation of collagen biosynthetic process	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	10856244
GO:0043371	Process	Negative regulation of CD4-positive, alpha-beta T cell differentiation	ISS
GO:0043378	Process	Positive regulation of CD8-positive, alpha-beta T cell differentiation	ISS
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9199349, 10207087, 11742995, 14970218
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9199349, 10207087, 14970218, 21873977
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9199349, 20972335
GO:0046982	Function	Protein heterodimerization activity	IDA	8413232
GO:0048935	Process	Peripheral nervous system neuron development	TAS	20096094
GO:0051094	Process	Positive regulation of developmental process	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0060043	Process	Regulation of cardiac muscle cell proliferation	ISS
GO:0061026	Process	Cardiac muscle tissue regeneration	ISS
GO:0071425	Process	Hematopoietic stem cell proliferation	TAS	21873977
GO:0140297	Function	DNA-binding transcription factor binding	IPI	9199349
GO:1903055	Process	Positive regulation of extracellular matrix organization	ISS
GO:1905203	Process	Regulation of connective tissue replacement	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000026	Process	Regulation of multicellular organismal development	IEA

MIM	HGNC	e!Ensembl
151385	10471	ENSG00000159216

Q01196

Protein name

Runt-related transcription factor 1 (Acute myeloid leukemia 1 protein) (Core-binding factor subunit alpha-2) (CBF-alpha-2) (Oncogene AML-1) (Polyomavirus enhancer-binding protein 2 alpha B subunit) (PEA2-alpha B) (PEBP2-alpha B) (SL3-3 enhancer factor 1 a

Protein function

Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their r

PDB

1CMO , 1CO1 , 1E50 , 1H9D , 1LJM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00853	Runt	51 → 180	Runt domain	Domain
PF08504	RunxI	362 → 453	Runx inhibition domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.

Sequence

MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL
TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPG
SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY

Sequence length

453

Interactions

View interactions

3039

Show/Hide Causal Diseases (19)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal bleeding	Pathogenic; Likely pathogenic	rs1569061762, rs1569061786, rs2057541324, rs1601515718, rs1060502579, rs2057998110	RCV001270615 RCV001270576 RCV001270495 RCV001270488 RCV001270534 RCV001270532
Abnormal platelet function	Pathogenic	rs1057519751	RCV000851801
Acute myeloid leukemia	Pathogenic; Likely pathogenic	rs2057541271, rs2145875208, rs759068561, rs1601516118, rs2517440416, rs2517038098, rs1057519750, rs1569084170, rs1601515707, rs1569084106, rs1601333612, rs2058002908	RCV001312236 RCV001376148 RCV005032022 RCV003465901 RCV003228178 RCV004574808 RCV000426735 RCV002499199 RCV002495048 RCV002279704 RCV003234570 RCV005038017
Atypical chronic myeloid leukemia, BCR-ABL1 negative	Likely pathogenic	rs2516817630	RCV003232902
Cervical cancer	Pathogenic	rs2145910195	RCV005926771
Clonal Cytopenia of Undetermined Significance	Likely pathogenic	rs1569078784	RCV003153243
Familial cancer of breast	Likely pathogenic	rs1601515718	RCV005920594
Hereditary cancer-predisposing syndrome	Pathogenic	rs2146410280	RCV002257292
Hereditary thrombocytopenia and hematologic cancer predisposition syndrome	Likely pathogenic; Pathogenic	rs2056458051, rs2057541271, rs2058004321, rs2056453893, rs1555899735, rs2145875208, rs2145910106, rs2146074811, rs2146075609, rs2146076572, rs2146234527, rs2146236515, rs2146410489, rs2146410761, rs2146413580 View all (140 more)	RCV002264780 RCV002264779 RCV003448392 RCV004699322 RCV004699326 RCV003448403 RCV002264783 RCV003448404 RCV003405628 RCV003448407 RCV003448405 RCV003448408 RCV002264785 RCV003448406 RCV002264786 RCV002264784 RCV002264820 RCV004699430 RCV005001235 RCV004692726 RCV004692761 RCV003448420 RCV004692766 RCV004699486 RCV004595634 RCV003448422 RCV002264833 RCV004699592 RCV004694016 RCV004693785 RCV004595642 RCV003448447 RCV004700697 RCV003448449 RCV003448450 RCV003448451 RCV003448452 RCV003448453 RCV004595657 RCV003448456 RCV003408207 RCV003448458 RCV004595660 RCV003448480 RCV004595667 RCV003448469 RCV003448467 RCV004595670 RCV004700841 RCV003448470 RCV004595673 RCV003448471 RCV004595674 RCV004700851 RCV004700850 RCV004695285 RCV004700889 RCV004700884 RCV005001341 RCV004700893 RCV003448474 RCV003448475 RCV004719311 RCV005001365 RCV003448491 RCV004701038 RCV005001375 RCV005001377 RCV004701056 RCV005001374 RCV003448648 RCV003448649 RCV004701088 RCV004701089 RCV005001389 RCV005252067 RCV004701729 RCV004701752 RCV005001401 RCV004701758 RCV005001404 RCV004701757 RCV004595486 RCV004700241 RCV004595487 RCV004595488 RCV004595489 RCV004595490 RCV005001413 RCV004701770 RCV004701771 RCV004701773 RCV004595712 RCV005001423 RCV004701778 RCV004701781 RCV005409951 RCV005001424 RCV005001427 RCV004701787 RCV005001426 RCV004701789 RCV004701790 RCV004701821 RCV005001451 RCV005001455 RCV005001468 RCV004595740 RCV004595741 RCV004595742 RCV004595743 RCV004595744 RCV004595745 RCV004595746 RCV004701462 RCV001290697 RCV001290696 RCV001290705 RCV001290699 RCV004701508 RCV004696233 RCV004701526 RCV004595509 RCV004701570 RCV004595515 RCV004595522 RCV004595523 RCV001290701 RCV001290700 RCV001290708 RCV004702312 RCV001197295 RCV001374726 RCV001195666 RCV004595528 RCV001374725 RCV003448335 RCV003448334 RCV001376067 RCV001290692 RCV004997137 RCV001195661 RCV001195652 RCV001374724 RCV002264724 RCV003448333 RCV003448332 RCV001195650 RCV001290702 RCV001197292 RCV001376068 RCV004595532 RCV003448344 RCV002264741 RCV002264733 RCV004702402 RCV002264732 RCV004692253 RCV003448349 RCV001195662 RCV000824708 RCV002264759 RCV002264758 RCV004595572 RCV004595571 RCV003448368 RCV004699188 RCV004695151 RCV002264769 RCV003448386 RCV002264771 RCV003448387 RCV003448388 RCV002264772
Hereditary thrombocytopenia and hematological cancer predisposition syndrome associated with RUNX1	Likely pathogenic; Pathogenic	rs2056453893, rs1555899735, rs2145910106, rs2146074811, rs2146075609, rs2146076572, rs2146234527, rs2146236515, rs2146410489, rs2146410761, rs2146413580, rs2146413726, rs2056452818, rs2057998063, rs2146360319 View all (102 more)	RCV001345771 RCV001349685 RCV001376889 RCV001384326 RCV001380693 RCV001387619 RCV001387019 RCV001387849 RCV001386548 RCV001387047 RCV001390537 RCV001381113 RCV003629190 RCV001869792 RCV001904996 RCV002039239 RCV001949655 RCV001963364 RCV001965204 RCV002033351 RCV002008165 RCV001982958 RCV002024005 RCV002245404 RCV002245413 RCV002245437 RCV002254233 RCV002254234 RCV002264885 RCV002280952 RCV002285101 RCV002291525 RCV002595241 RCV002573638 RCV002828118 RCV002801894 RCV002823682 RCV002828887 RCV002851376 RCV002862143 RCV002861546 RCV002863135 RCV002863808 RCV002893851 RCV003021374 RCV003016883 RCV002996576 RCV003034342 RCV003026488 RCV003047176 RCV003050216 RCV003228178 RCV005100107 RCV003515411 RCV003515504 RCV003513914 RCV003516182 RCV003516290 RCV003514840 RCV003514978 RCV003515226 RCV003515157 RCV003515158 RCV000015549 RCV000015550 RCV000015551 RCV000015552 RCV000015553 RCV000015554 RCV000015557 RCV000015558 RCV003630122 RCV003630265 RCV003630269 RCV003630421 RCV003630414 RCV003630711 RCV003630705 RCV003630725 RCV003630730 RCV003630792 RCV003630915 RCV003630952 RCV003630889 RCV003630986 RCV003630987 RCV003629869 RCV003854252 RCV000824700 RCV001039570 RCV001204199 RCV003448309 RCV000473754 RCV000466387 RCV000477937 RCV000500217 RCV000549717 RCV000639524 RCV000656502 RCV002472312 RCV001078214 RCV000799444 RCV002531413 RCV000824707 RCV002499199 RCV005091981 RCV000692523 RCV001078218 RCV005092221 RCV000793877 RCV000801548 RCV000796520 RCV002549217 RCV003769399 RCV001037580 RCV001078213 RCV001078217 RCV001078212 RCV001078216 RCV001198837 RCV001202518 RCV001213758 RCV001215896 RCV001257572 RCV002280903
Inherited bleeding disorder, platelet-type	Pathogenic	rs1060499616	RCV001270105
Myelodysplasia	Likely pathogenic	rs2056458051	RCV001312237
Neoplasm	Pathogenic	rs1569061768	RCV005231259
Pancytopenia	Likely pathogenic	rs1569078784	RCV000851806
RUNX1-related disorder	Pathogenic; Likely pathogenic	rs1601516118, rs2517486812, rs1601333612, rs2517482498, rs2516820446, rs1057519748, rs1060499616, rs1569084116, rs1569084170, rs1569061786, rs1476636108	RCV004725467 RCV003416650 RCV003400454 RCV003393038 RCV003414449 RCV003932542 RCV004742442 RCV003389725 RCV003892030 RCV004723162 RCV003396736
Storage pool disease of platelets	Pathogenic	rs1601415426, rs1601416036	RCV000852220 RCV000851832
Thrombocytopenia	Pathogenic; Likely pathogenic	rs2058004321, rs1569061762, rs1569061768, rs1060502579, rs1569008655, rs121912499, rs1569061786, rs1569084106, rs1601515718, rs2057541324, rs2057998110	RCV001312234 RCV001003538 RCV001003539 RCV001312235 RCV000851916 RCV000851904 RCV000852167 RCV001003541 RCV001003540 RCV001270495 RCV001270488 RCV001270534 RCV001270532
Thyroid cancer, nonmedullary, 1	Likely pathogenic	rs2057997150	RCV005934839
Uterine corpus endometrial carcinoma	Pathogenic	rs1601515718	RCV005912363

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Aggressive systemic mastocytosis	Uncertain significance	rs202068364, rs2056451534	RCV005365328 RCV005367803
Anaplastic ependymoma	Likely benign	rs200431130	RCV000761084
Castleman-Kojima disease	Uncertain significance	rs561166961	RCV000824697
Colon adenocarcinoma	Benign	rs59802347	RCV005895255
Gastric cancer	Benign	rs73900787	RCV005914595
LEUKEMIA, ACUTE MYELOID, M0 SUBTYPE	Likely benign	rs121912500	RCV000015556
Lung cancer	Benign	rs9981811, rs59802347	RCV005917346 RCV005895258
Malignant tumor of esophagus	Benign	rs73900787, rs9981811	RCV005914592 RCV005917341
Ovarian serous cystadenocarcinoma	Benign	rs59802347	RCV005895256
Sarcoma	Benign	rs73900787, rs9981811, rs188246960, rs113375138	RCV005914594 RCV005917343 RCV005897483 RCV005897484
Thymoma	Benign	rs9981811	RCV005917345
TRANSIENT MYELOPROLIFERATIVE DISORDER OF DOWN SYNDROME	Likely benign	rs121912500	RCV000015555
Uterine carcinosarcoma	Benign	rs9981811	RCV005917344

Show/Hide Text Mining Associations (251)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute erythroleukemia	Associate	9432044
Acute Radiation Syndrome	Associate	15988144
Adenocarcinoma	Associate	22143938, 35396535
Adenocarcinoma of Lung	Associate	28926105
Alzheimer Disease	Associate	37774680, 40037709
Anemia	Associate	37160316
Anemia Aplastic	Associate	33166403
Anodontia	Associate	36321611
Aortic Aneurysm Abdominal	Associate	25993293
Aortic Valve Stenosis	Associate	37175670
Arthritis Juvenile	Associate	25540605
Arthritis Rheumatoid	Associate	22449398, 32831971, 35304503
Asthma	Associate	16519819
Ataxia Telangiectasia	Associate	20861459
Atherosclerosis	Associate	35304503
Atrophy	Associate	25289940
Atypical Squamous Cells of the Cervix	Associate	37160316
Autoimmune Diseases	Associate	16249223, 35220890
Beta ketothiolase deficiency	Associate	27997762
Bjornstad syndrome	Associate	19808697, 22915647, 24611505, 37558665
Blast Crisis	Associate	18202228, 32366154, 33990592
Blast Injuries	Associate	16532439, 18790797, 32782381
Blood Platelet Disorders	Associate	20181616, 20876458, 21129147, 22898599, 24606315, 24853048, 27112265, 27997762, 29632235, 30545930, 33560381, 36736831, 37738626
Bone Marrow Diseases	Associate	28659335, 35427424
Bone Marrow Failure Disorders	Associate	25239263, 29463756
Bone Neoplasms	Associate	23199169
Bradycardia	Associate	34004232
Brain Neoplasms	Associate	34440820
Breast Carcinoma In Situ	Associate	31932682, 35477749
Breast Neoplasms	Inhibit	20169162, 28407681, 31919859
Breast Neoplasms	Associate	22024923, 24036662, 24337772, 24967588, 26920143, 27428424, 27514584, 28055379, 28590426, 28747748, 31757997, 32506995, 33191115, 38235137
Calcinosis Cutis	Associate	36766786
Carcinogenesis	Associate	22024923, 22158627, 23569218
Carcinoma Endometrioid	Associate	24756106
Carcinoma Hepatocellular	Inhibit	17094378
Carcinoma Hepatocellular	Associate	31646558
Carcinoma Intraductal Noninfiltrating	Associate	28338653
Carcinoma Large Cell	Associate	30793508
Carcinoma Lobular	Associate	35477749
Carcinoma Non Small Cell Lung	Associate	26685324, 33407425, 37967345
Carcinoma Ovarian Epithelial	Associate	23442798, 32142859, 37817210
Carcinoma Pancreatic Ductal	Associate	35197278, 36302831
Carcinoma Renal Cell	Stimulate	24783204, 34294773
Carcinoma Renal Cell	Associate	31739630, 33070555, 33932757
Cardiovascular Diseases	Associate	27566955
Cell Transformation Viral	Associate	15142876, 19850737, 28513614, 29467191, 30709863, 36727400
Central Nervous System Diseases	Associate	21822204
Cerulean cataract	Associate	20064152
Cholangiocarcinoma	Associate	31015363
Chromosome 21 monosomy	Associate	31456164
Chromosome 7 monosomy	Associate	33200495
Chromosome 8 trisomy	Associate	35549661
Chromosome Aberrations	Associate	11167742, 11559948, 1698479, 20085575, 22404039, 23877199, 28349830, 32366154, 35470277
Chromosome Disorders	Associate	11167742
Cognitive Dysfunction	Associate	26628061
Colonic Neoplasms	Associate	21088106
Colorectal Neoplasms	Associate	21088106, 21365634, 27566955, 28376129, 28675510, 32866710, 33462242, 34376784, 35534796
Common Variable Immunodeficiency	Inhibit	29345621
Congenital Bone Marrow Failure Syndromes	Associate	29146883, 37391485
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	22722193
Conversion Disorder	Associate	24606315
COVID 19	Associate	11264187
Cranial Nerve Diseases	Associate	28993357
Cyclic neutropenia	Associate	37406166
Death	Associate	25596267, 25692130, 30289875, 36550215
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	20181616
Diabetes Mellitus	Associate	31626638, 32573975
Diabetes Mellitus Type 2	Associate	23028138, 23626757, 33902539
Diabetic Foot	Associate	32573975
Diabetic Nephropathies	Associate	34735495
Disease	Associate	21723253, 23680131, 24616160, 27506214, 28089879
Dissection Thoracic Aorta	Associate	29669321, 30066903
Down Syndrome	Associate	11023523, 16965388, 18202228, 19357396, 21527530, 25701644, 27134169, 27618722, 28590426, 30989628, 31385395, 32861879, 33001180, 33633844, 34795060, 36625318, 38513239 View all (2 more)
Down Syndrome	Inhibit	18487507, 19638627
Emanuel syndrome	Associate	33433047
Endometrial Neoplasms	Associate	37612452
Endometriosis	Associate	26134036
Eosinophilic Esophagitis	Associate	35839075
Epidermolysa bullosa simplex and limb girdle muscular dystrophy	Associate	18925961
Epstein Barr Virus Infections	Inhibit	19403666
Epstein Barr Virus Infections	Associate	36965331
Esophageal Neoplasms	Associate	22751462
Esophageal Squamous Cell Carcinoma	Associate	22865593, 32662828
Exophthalmos	Associate	28993357
Fanconi Anemia	Associate	21325596, 37391485
Fatty Liver	Stimulate	34063472
Fibrosis	Associate	37604222
Gastrointestinal Neoplasms	Inhibit	27566955
Gastrointestinal Neoplasms	Associate	36681091
GATA2 Deficiency	Associate	26693794
Genetic Diseases Inborn	Associate	12393679, 15650049, 16938118, 21198299, 25764068, 26429121, 33560381, 36736831, 37738626
Genomic Instability	Associate	32397113
Glioblastoma	Associate	22000015, 25903924, 28012022, 34440820, 34895074, 36949071, 37357610, 38286983
Glioma	Stimulate	34088969
Glioma	Associate	34440820, 35534796, 36321611, 36776876
Glucocorticoid Receptor Deficiency	Associate	34262023
Graves Disease	Associate	35220890
Head and Neck Neoplasms	Associate	21723253
Heart Defects Congenital	Associate	22318994, 33001180
Hematologic Diseases	Associate	10648391, 32544910
Hematologic Neoplasms	Associate	19773259, 22102704, 25879624, 26910834, 27365488, 28536267, 28659335, 29365323, 31648317, 32299907, 32315381, 33950983, 34019812, 34082071, 34424323 View all (8 more)
Hematologic Neoplasms	Inhibit	22024923
Hemochromatosis	Associate	36321611
Hemorrhage	Associate	24100448, 34424323
Hepatitis B	Associate	33890726
Hepatopulmonary Syndrome	Associate	20346360
Histiocytosis	Associate	32051554
Hypertension	Associate	34987319
Hypomagnesemia primary	Associate	16532439, 25381062, 35470277, 35572839
Hypoxia	Inhibit	23492767
Hypoxia Brain	Associate	34073090
Ichthyosis prematurity syndrome	Associate	29290585
Immune System Diseases	Associate	36754216
Immunoglobulin G4 Related Disease	Associate	23230269
Immunologic Deficiency Syndromes	Associate	35839075
Infections	Associate	21670465, 26237075, 28129329
Infections	Stimulate	32265900
Infections	Inhibit	35248104
Inflammation	Associate	32051554, 32265900, 34063472, 35248104
Inflammation	Stimulate	32118299
Intervertebral Disc Degeneration	Associate	32659941
Intervertebral disc disease	Associate	32659941
Iron Overload	Associate	40635108
Isodicentric Chromosome 15 Syndrome	Associate	16989659, 18663147, 21198299, 23878140, 24055056, 25381062
Jacobsen Distal 11q Deletion Syndrome	Associate	28114278
Kidney Neoplasms	Associate	25994056, 35534796
Leukemia	Associate	10068652, 10419898, 10861016, 10882117, 11001911, 11023523, 11049997, 11090081, 11742995, 11830488, 11867721, 12048236, 12086872, 12427969, 12480707 View all (124 more)
Leukemia B Cell	Associate	18815194, 36930401
Leukemia Biphenotypic Acute	Associate	11841400, 11841426, 16965388, 18275435, 19403666, 20085575, 21173572, 24769646, 27265895, 32150610, 33164984, 33739852, 33890726, 34101758, 34424323 View all (7 more)
Leukemia Erythroblastic Acute	Associate	20181616, 29632235, 35839075
Leukemia Hairy Cell	Associate	23971860
Leukemia Large Granular Lymphocytic	Associate	37142644
Leukemia Lymphocytic Chronic B Cell	Associate	29672642
Leukemia Mast Cell	Associate	28255023, 36094848
Leukemia Megakaryoblastic Acute	Associate	19638627, 22122069
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15326310, 16532439, 18202228, 28452984, 29967129, 32299907, 32366154, 32782381, 40344211, 8490181
Leukemia Myeloid	Associate	10188872, 16532439, 18687517, 18809762, 26671595, 28536267, 28926105, 32544910, 8639909, 8643684, 9763573
Leukemia Myeloid Acute	Associate	10068652, 10520027, 10611307, 10845943, 10861016, 11023523, 11090081, 11113190, 11122105, 11150306, 11463839, 11675361, 11830488, 11867721, 11986239 View all (276 more)
Leukemia Myeloid Acute	Inhibit	11264187, 32071087
Leukemia Myeloid Acute	Stimulate	27903959
Leukemia Myeloid Chronic Atypical BCR ABL Negative	Associate	28314085
Leukemia Myeloid Chronic Phase	Associate	32782381
Leukemia Myelomonocytic Acute	Associate	28513614, 37904382
Leukemia Myelomonocytic Chronic	Associate	18925961, 22138511, 23065512, 24595958, 26648538, 27385790, 29728305, 35236051, 39337700
Leukemia Myelomonocytic Juvenile	Associate	20955399
Leukemia Neutrophilic Chronic	Associate	33166403
Leukemia Promyelocytic Acute	Associate	11090081, 33019444
Leukemia Radiation Induced	Associate	11264187
Leukemia T Cell	Associate	10188872, 12719399, 15257702, 15298716, 16989659, 17539775, 17622527, 20497575, 21488857, 27252013, 28542718, 35644277, 36380727, 9207408
Leukemia T Cell	Inhibit	24967588
Li Fraumeni Syndrome	Associate	27210295
Light Fixation Seizure Syndrome	Associate	36645547
Liver Diseases	Associate	33560381
Lung Neoplasms	Associate	28926105, 29914443, 33407425
Lymphangioleiomyomatosis	Associate	34312290
Lymphohistiocytosis Hemophagocytic	Associate	30383631
Lymphoma	Associate	24574234, 38172714
Lymphoma B Cell	Associate	19403666
Lymphoma Follicular	Associate	7761424
Lymphoma Large B Cell Diffuse	Associate	34698360, 38172714
Lymphoma Non Hodgkin	Associate	36321611
Mast Cell Activation Disorders	Inhibit	21488857
Mastocytosis	Associate	35765876
Mastocytosis Systemic	Associate	23958953, 27214377, 28424161, 30152525, 30373888, 31151985, 31509472, 33391475, 35765876, 37309222
Melanoma	Associate	29422114, 34673281
Menkes Kinky Hair Syndrome	Associate	29417633
Mitochondrial Diseases	Stimulate	36625318
Mouth Diseases	Associate	34376784
Multi centric Castleman's Disease	Associate	32051554
Multiple Myeloma	Associate	12560229
Multiple Sclerosis	Inhibit	36754216
Multiple Sclerosis Relapsing Remitting	Associate	36754216
Myelodysplastic Myeloproliferative Diseases	Associate	20421268, 20955399, 22571758, 28933735, 33845873, 39337700
Myelodysplastic Syndromes	Associate	11023523, 11049997, 11867721, 12393679, 15988144, 16532439, 17485549, 17910630, 17976519, 18202228, 18724045, 19144660, 19569249, 19808697, 20678218 View all (54 more)
Myeloproliferative Disorders	Associate	24595958, 29728305
Neoplasm Metastasis	Associate	15257702, 28012022
Neoplasm Residual	Associate	10774753, 11167742, 12491511, 18928518
Neoplasms	Associate	11023523, 11675361, 15741216, 16532439, 17485549, 18166807, 18511808, 18723428, 19850737, 20339092, 21088106, 21346257, 21531982, 21670465, 21828118 View all (58 more)
Neoplasms	Inhibit	14561740, 17539775, 20169162, 20651033, 22024923, 22366949, 24967588, 27514584, 27566955, 28055379, 28926105, 30792202, 31919859, 35644277
Neoplasms	Stimulate	25565632, 32866710, 36766786
Neoplasms Second Primary	Associate	15142876, 20861459, 33579957
Neural Tube Defects	Associate	15142876, 15705784, 18723428, 21325596, 22950073, 24853048, 26671595, 32091281, 39201354, 8171026
Neutropenia severe chronic	Associate	37989463
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	24523240, 33166403, 33894142
Neutrophil Immunodeficiency Syndrome	Associate	36943669
Non alcoholic Fatty Liver Disease	Associate	34063472
Obesity	Associate	32188105, 33902539
Olfaction Disorders	Associate	38369189
Osteoporosis	Associate	37335694
Ovarian Diseases	Stimulate	23442798
Ovarian Neoplasms	Associate	23200915, 29445078, 35867729
Pancreatic Neoplasms	Associate	35197278
Parkinson Disease 12	Associate	10774753, 11841400, 18241254, 26580398, 7492786, 9207408, 9226156, 9233592
Pdgfrb Associated Chronic Eosinophilic Leukemia	Associate	16532439, 32051554
Pediatric Obesity	Associate	12719399
Peeling Skin Syndrome	Associate	22869879
Peri Implantitis	Associate	39934011
Philadelphia Chromosome	Associate	26802623
Pituitary Neoplasms	Associate	19020999
Platelet Disorder Familial with Associated Myeloid Malignancy	Associate	11675361, 11830488, 12393679, 15741216, 18166807, 18723428, 19357396, 22138511, 22898599, 23971860, 24606315, 26021490, 27112265, 27210295, 27997762 View all (16 more)
Platelet Factor 3 Deficiency	Associate	21129147
Platelet granule deficiency disorder	Associate	24100448, 35839075
Polycythemia Vera	Stimulate	20339092
Polycythemia Vera	Associate	23538339
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	11841426, 22911440, 24632701, 25137060, 25273558, 27536776, 28063722, 29290585, 29632299, 30115129, 30487223, 31944572, 33743795, 34982829, 36538046, 8704188, 9763573 View all (2 more)
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10419898, 10597047, 10774753, 10910927, 11157492, 11274424, 11468150, 11867721, 12060124, 12091359, 12433682, 12491511, 12506024, 15114604, 15142881 View all (91 more)
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	11001911
Precursor Cell Lymphoblastic Leukemia Lymphoma	Stimulate	28349830
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10856244, 11091202, 11167739, 11167742, 11841400, 11841426, 12060124, 12771199, 15257702, 15298716, 15667533, 15877731, 15988144, 16938118, 16965388 View all (32 more)
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	22366949
Prehypertension	Associate	26580398, 36411286
Primary Immunodeficiency Diseases	Associate	21670465
Primary Myelofibrosis	Associate	16532439, 20339092, 25252869, 37846894
Prostatic Neoplasms	Associate	25537508, 36766786
Psoriasis	Associate	16519819
Purpura Thrombocytopenic Idiopathic	Associate	26628061, 26884589
Radiation Injuries	Associate	10845943, 11264187, 15988144
Rectal Neoplasms	Associate	21088106
Renal cell carcinoma 1	Associate	24055056
Retinopathy of Prematurity	Associate	40084286
Rhabdoid Tumor	Associate	36572559
Sarcoma Myeloid	Associate	29151502, 31899799, 36916780
Scleroderma Diffuse	Associate	24812288
Shwachman Diamond Syndrome	Inhibit	17539775
Sick Sinus Syndrome	Associate	34004232
Sjogren's Syndrome	Associate	24574234
Skin Diseases	Associate	30373888
Sleep Apnea Obstructive	Associate	34987319
Sleep Disorders Circadian Rhythm	Associate	40188457
Splenomegaly	Associate	30373888
Squamous Cell Carcinoma of Head and Neck	Associate	25760063, 34606420
ST Elevation Myocardial Infarction	Associate	38597542
Stomach Neoplasms	Associate	26931432, 28835317, 29686309, 33090400
Syndrome	Associate	37406166
Tetra amelia with ectodermal dysplasia and lacrimal duct abnormalities	Associate	16965388, 18241254, 20513752
Thrombasthenia Thrombocytopenia Hereditary	Associate	34019812
Thrombocythemia Essential	Associate	11023523
Thrombocythemia Essential	Stimulate	20339092
Thrombocytopenia	Associate	12060124, 15741216, 18487507, 20181616, 20876458, 21129147, 21339820, 21714648, 22102704, 23971860, 24100448, 24606315, 25490895, 26021490, 26514544 View all (14 more)
Thrombocytopenia chromosome breakage	Associate	24430186, 27365488
Thyroid Cancer Papillary	Associate	17914110
Thyroid Neoplasms	Stimulate	19536094
Tomaculous neuropathy	Associate	27112265
Triple Negative Breast Neoplasms	Associate	24967588, 28590426, 36766786
Trisomy 13 Syndrome	Associate	17485549, 17650443
Tukel syndrome	Associate	22571758
Uniparental Disomy	Associate	28513614
Uterine Cervical Neoplasms	Associate	35534796
Uveal melanoma	Associate	30347896
VLCAD deficiency	Associate	33200495
Von Willebrand disease platelet type	Associate	34019812

RUNX1 (RUNX family transcription factor 1)