Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6198
Gene name Gene Name - the full gene name approved by the HGNC.
Ribosomal protein S6 kinase B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RPS6KB1
Synonyms (NCBI Gene) Gene synonyms aliases
PS6K, S6K, S6K-beta-1, S6K1, STK14A, p70 S6KA, p70(S6K)-alpha, p70-S6K, p70-alpha
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this ge
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024333 hsa-miR-215-5p Microarray 19074876
MIRT026123 hsa-miR-192-5p Microarray 19074876
MIRT027002 hsa-miR-103a-3p Sequencing 20371350
MIRT027419 hsa-miR-98-5p Microarray 19088304
MIRT031441 hsa-miR-16-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IMP 14673156
GO:0001662 Process Behavioral fear response IEA
GO:0003009 Process Skeletal muscle contraction IEA
GO:0004672 Function Protein kinase activity IDA 17936702, 18952604
GO:0004674 Function Protein serine/threonine kinase activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608938 10436 ENSG00000108443
Protein
UniProt ID P23443
Protein name Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (
Protein function Serine/threonine-protein kinase that acts downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression (PubMed:11500364, PubMed:12801526, PubMed:14673156, PubMed:1
PDB 3A60 , 3A61 , 3A62 , 3WE4 , 3WF5 , 3WF6 , 3WF7 , 3WF8 , 3WF9 , 4L3J , 4L3L , 4L42 , 4L43 , 4L44 , 4L45 , 4L46 , 4RLO , 4RLP , 5WBH , 5WBK , 7N91 , 7N93
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 91 352 Protein kinase domain Domain
PF00433 Pkinase_C 373 413 Protein kinase C terminal domain Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9804755}.
Sequence
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFF
RHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Sequence length 525
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Hypertrophic cardiomyopathy hypertrophic cardiomyopathy GenCC
Multiple Sclerosis Multiple Sclerosis GWAS
Diabetes Diabetes GWAS
Dyslexia Dyslexia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acidosis Renal Tubular Associate 30483732
Acrodermatitis Associate 24558502
Adenocarcinoma Associate 25134527, 27503924
Adenocarcinoma of Lung Associate 28302721, 28792981, 37011005
Alzheimer Disease Associate 16364302, 21811019
Ameloblastoma Associate 22977662
Angiomyolipoma Associate 23705901
Arthritis Rheumatoid Associate 11879539, 28387872, 31028998, 32867828
Barrett Esophagus Associate 18413730, 27503924
Brain Diseases Associate 26239490