Gene Gene information from NCBI Gene database.
Entrez ID 6198
Gene name Ribosomal protein S6 kinase B1
Gene symbol RPS6KB1
Synonyms (NCBI Gene)
PS6KS6KS6K-beta-1S6K1STK14Ap70 S6KAp70(S6K)-alphap70-S6Kp70-alpha
Chromosome 17
Chromosome location 17q23.1
Summary This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this ge
miRNA miRNA information provided by mirtarbase database.
1146
miRTarBase ID miRNA Experiments Reference
MIRT024333 hsa-miR-215-5p Microarray 19074876
MIRT026123 hsa-miR-192-5p Microarray 19074876
MIRT027002 hsa-miR-103a-3p Sequencing 20371350
MIRT027419 hsa-miR-98-5p Microarray 19088304
MIRT031441 hsa-miR-16-5p Sequencing 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
84
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IDA 28890335
GO:0000082 Process G1/S transition of mitotic cell cycle IMP 14673156
GO:0000166 Function Nucleotide binding IEA
GO:0001662 Process Behavioral fear response IEA
GO:0002181 Process Cytoplasmic translation IDA 8706699, 34314702
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608938 10436 ENSG00000108443
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P23443
Protein name Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine-protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (
Protein function Serine/threonine-protein kinase that acts downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression (PubMed:11500364, PubMed:12801526, PubMed:14673156, PubMed:1
PDB 3A60 , 3A61 , 3A62 , 3WE4 , 3WF5 , 3WF6 , 3WF7 , 3WF8 , 3WF9 , 4L3J , 4L3L , 4L42 , 4L43 , 4L44 , 4L45 , 4L46 , 4RLO , 4RLP , 5WBH , 5WBK , 7N91 , 7N93
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 91 352 Protein kinase domain Domain
PF00433 Pkinase_C 373 413 Protein kinase C terminal domain Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9804755}.
Sequence
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFF
RHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Sequence length 525
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
12
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs74702949 RCV005909984
Cervical cancer Benign rs74702949 RCV005909986
Cholangiocarcinoma Benign rs74702949 RCV005909993
Clear cell carcinoma of kidney Benign rs74702949 RCV005909987
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Renal Tubular Associate 30483732
Acrodermatitis Associate 24558502
Adenocarcinoma Associate 25134527, 27503924
Adenocarcinoma of Lung Associate 28302721, 28792981, 37011005
Alzheimer Disease Associate 16364302, 21811019
Ameloblastoma Associate 22977662
Angiomyolipoma Associate 23705901
Arthritis Rheumatoid Associate 11879539, 28387872, 31028998, 32867828
Barrett Esophagus Associate 18413730, 27503924
Brain Diseases Associate 26239490