Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6093
Gene name Gene Name - the full gene name approved by the HGNC.	Rho associated coiled-coil containing protein kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ROCK1
Synonyms (NCBI Gene) Gene synonyms aliases	P160ROCK, ROCK-I
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q11.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets a

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057520015	G>A	Likely-pathogenic	Missense variant, coding sequence variant

Show/Hide all(409)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000945	hsa-miR-146a-5p	flow, Western blot, Northern blot	18174313
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assay	18174313
MIRT004047	hsa-miR-584-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21119662
MIRT004047	hsa-miR-584-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21119662
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT007315	hsa-miR-148b-3p	Western blot	23238785
MIRT007315	hsa-miR-148b-3p	Western blot	23238785
MIRT053076	hsa-miR-335-5p	Luciferase reporter assay, qRT-PCR, Western blot	23975506
MIRT053483	hsa-miR-148a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21994419
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	25169484
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	25169484
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, Western blot	24465504
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT053483	hsa-miR-148a-3p	Luciferase reporter assay	23670799
MIRT438654	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	23872151
MIRT438654	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	23872151
MIRT438282	hsa-miR-145-5p	Luciferase reporter assay, Western blot	24573110
MIRT438282	hsa-miR-145-5p	Luciferase reporter assay, Western blot	24573110
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay, Western blot, qRT-PCR	23936026
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24465504
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24465504
MIRT438654	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	23872151
MIRT438654	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	23872151
MIRT438282	hsa-miR-145-5p	Luciferase reporter assay, Western blot	24573110
MIRT438282	hsa-miR-145-5p	Luciferase reporter assay, Western blot	24573110
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay, Western blot, qRT-PCR	23936026
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24465504
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24465504
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22291592
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22291592
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22291592
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22291592
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	23708386
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	23708386
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	23708386
MIRT494989	hsa-miR-3688-3p	PAR-CLIP	23708386
MIRT494988	hsa-miR-548aj-5p	PAR-CLIP	23708386
MIRT494987	hsa-miR-548f-5p	PAR-CLIP	23708386
MIRT494986	hsa-miR-548g-5p	PAR-CLIP	23708386
MIRT494985	hsa-miR-548x-5p	PAR-CLIP	23708386
MIRT494984	hsa-miR-1468-3p	PAR-CLIP	23708386
MIRT494983	hsa-miR-5093	PAR-CLIP	23708386
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	23708386
MIRT494982	hsa-miR-548aw	PAR-CLIP	23708386
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22100165
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22100165
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT731498	hsa-miR-300	Luciferase reporter assay	27145462
MIRT731498	hsa-miR-300	Luciferase reporter assay	27145462
MIRT731717	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26474697
MIRT731717	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26474697
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26306811
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26306811
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay, Western blot	26530325
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay, Western blot	26530325
MIRT054402	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25065599
MIRT054402	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25065599
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT053076	hsa-miR-335-5p	Luciferase reporter assay, Western blot	27035227
MIRT053076	hsa-miR-335-5p	Luciferase reporter assay, Western blot	27035227
MIRT732668	hsa-miR-136-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33717260
MIRT053076	hsa-miR-335-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31638991
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), In situ hybridization, Microarray, Western blotting	33168781
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), In situ hybridization, Microarray, Western blotting	33168781
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), In situ hybridization, Microarray, Western blotting	33168781
MIRT733939	hsa-miR-501-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33168781
MIRT733939	hsa-miR-501-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33168781
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22291592
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22291592
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22291592
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22291592
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	23708386
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	23708386
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	23708386
MIRT494989	hsa-miR-3688-3p	PAR-CLIP	23708386
MIRT494988	hsa-miR-548aj-5p	PAR-CLIP	23708386
MIRT494987	hsa-miR-548f-5p	PAR-CLIP	23708386
MIRT494986	hsa-miR-548g-5p	PAR-CLIP	23708386
MIRT494985	hsa-miR-548x-5p	PAR-CLIP	23708386
MIRT494984	hsa-miR-1468-3p	PAR-CLIP	23708386
MIRT494983	hsa-miR-5093	PAR-CLIP	23708386
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	23708386
MIRT494982	hsa-miR-548aw	PAR-CLIP	23708386
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22100165
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22100165
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT755857	hsa-miR-448	Luciferase reporter assay, Western blotting, qRT-PCR	35281946
MIRT053483	hsa-miR-148a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35127282
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT1314630	hsa-miR-1297	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314632	hsa-miR-142-5p	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314636	hsa-miR-196a	CLIP-seq
MIRT1314637	hsa-miR-196b	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT1314640	hsa-miR-26a	CLIP-seq
MIRT1314641	hsa-miR-26b	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT1314644	hsa-miR-3126-3p	CLIP-seq
MIRT1314645	hsa-miR-3140-3p	CLIP-seq
MIRT1314646	hsa-miR-3148	CLIP-seq
MIRT1314647	hsa-miR-3171	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT1314649	hsa-miR-3200-5p	CLIP-seq
MIRT1314650	hsa-miR-337-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT1314655	hsa-miR-3689a-5p	CLIP-seq
MIRT1314656	hsa-miR-3689b	CLIP-seq
MIRT1314657	hsa-miR-3689e	CLIP-seq
MIRT1314658	hsa-miR-3689f	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314660	hsa-miR-371-5p	CLIP-seq
MIRT1314661	hsa-miR-371b-5p	CLIP-seq
MIRT1314662	hsa-miR-381	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT1314665	hsa-miR-4255	CLIP-seq
MIRT1314666	hsa-miR-4263	CLIP-seq
MIRT1314667	hsa-miR-4328	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT1314669	hsa-miR-4465	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314670	hsa-miR-4490	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314673	hsa-miR-450b-5p	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT1314675	hsa-miR-4666-3p	CLIP-seq
MIRT1314676	hsa-miR-4670-3p	CLIP-seq
MIRT1314677	hsa-miR-4690-5p	CLIP-seq
MIRT1314678	hsa-miR-4698	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT1314681	hsa-miR-4774-5p	CLIP-seq
MIRT1314682	hsa-miR-4781-3p	CLIP-seq
MIRT1314683	hsa-miR-4789-5p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT1314685	hsa-miR-488	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT1314688	hsa-miR-507	CLIP-seq
MIRT1314689	hsa-miR-508-3p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT1314695	hsa-miR-557	CLIP-seq
MIRT1314696	hsa-miR-570	CLIP-seq
MIRT1314697	hsa-miR-582-3p	CLIP-seq
MIRT1314698	hsa-miR-605	CLIP-seq
MIRT1314699	hsa-miR-628-5p	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT1314701	hsa-miR-875-3p	CLIP-seq
MIRT1314702	hsa-miR-888	CLIP-seq
MIRT2093563	hsa-miR-1244	CLIP-seq
MIRT2093564	hsa-miR-1251	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT1314630	hsa-miR-1297	CLIP-seq
MIRT2093565	hsa-miR-148a	CLIP-seq
MIRT2093566	hsa-miR-148b	CLIP-seq
MIRT2093567	hsa-miR-150	CLIP-seq
MIRT2093568	hsa-miR-152	CLIP-seq
MIRT2093569	hsa-miR-224	CLIP-seq
MIRT2093570	hsa-miR-2355-3p	CLIP-seq
MIRT1314640	hsa-miR-26a	CLIP-seq
MIRT1314641	hsa-miR-26b	CLIP-seq
MIRT2093571	hsa-miR-3149	CLIP-seq
MIRT2093572	hsa-miR-3157-5p	CLIP-seq
MIRT2093573	hsa-miR-3160-5p	CLIP-seq
MIRT2093574	hsa-miR-3183	CLIP-seq
MIRT2093575	hsa-miR-325	CLIP-seq
MIRT2093576	hsa-miR-335	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT2093577	hsa-miR-34c-3p	CLIP-seq
MIRT2093578	hsa-miR-3616-5p	CLIP-seq
MIRT2093579	hsa-miR-3647-5p	CLIP-seq
MIRT1314655	hsa-miR-3689a-5p	CLIP-seq
MIRT1314656	hsa-miR-3689b	CLIP-seq
MIRT1314657	hsa-miR-3689e	CLIP-seq
MIRT1314658	hsa-miR-3689f	CLIP-seq
MIRT2093580	hsa-miR-3909	CLIP-seq
MIRT2093581	hsa-miR-4307	CLIP-seq
MIRT2093582	hsa-miR-431	CLIP-seq
MIRT1314669	hsa-miR-4465	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2093583	hsa-miR-4646-3p	CLIP-seq
MIRT1314676	hsa-miR-4670-3p	CLIP-seq
MIRT2093584	hsa-miR-4691-3p	CLIP-seq
MIRT2093585	hsa-miR-4696	CLIP-seq
MIRT2093586	hsa-miR-4713-5p	CLIP-seq
MIRT2093587	hsa-miR-4723-3p	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT2093588	hsa-miR-532-3p	CLIP-seq
MIRT2093589	hsa-miR-539	CLIP-seq
MIRT2093590	hsa-miR-548ae	CLIP-seq
MIRT2093591	hsa-miR-548aj	CLIP-seq
MIRT2093592	hsa-miR-548am	CLIP-seq
MIRT2093593	hsa-miR-548c-3p	CLIP-seq
MIRT2093594	hsa-miR-548x	CLIP-seq
MIRT2093595	hsa-miR-567	CLIP-seq
MIRT2093596	hsa-miR-568	CLIP-seq
MIRT1314696	hsa-miR-570	CLIP-seq
MIRT2093597	hsa-miR-573	CLIP-seq
MIRT2093598	hsa-miR-579	CLIP-seq
MIRT2093599	hsa-miR-587	CLIP-seq
MIRT2093600	hsa-miR-593	CLIP-seq
MIRT2093601	hsa-miR-607	CLIP-seq
MIRT2093602	hsa-miR-628-3p	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT2093603	hsa-miR-664	CLIP-seq
MIRT2093604	hsa-miR-676	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318102	hsa-miR-1284	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314632	hsa-miR-142-5p	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT2093565	hsa-miR-148a	CLIP-seq
MIRT2093566	hsa-miR-148b	CLIP-seq
MIRT2093568	hsa-miR-152	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314636	hsa-miR-196a	CLIP-seq
MIRT1314637	hsa-miR-196b	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT1314649	hsa-miR-3200-5p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT2318106	hsa-miR-3646	CLIP-seq
MIRT2318107	hsa-miR-3663-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314662	hsa-miR-381	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT1314667	hsa-miR-4328	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT2318109	hsa-miR-4470	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314673	hsa-miR-450b-5p	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT1314675	hsa-miR-4666-3p	CLIP-seq
MIRT1314677	hsa-miR-4690-5p	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT2318112	hsa-miR-4719	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT2318113	hsa-miR-4729	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT2318116	hsa-miR-4797-5p	CLIP-seq
MIRT1314685	hsa-miR-488	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT1314688	hsa-miR-507	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2318119	hsa-miR-513b	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT1314695	hsa-miR-557	CLIP-seq
MIRT2093601	hsa-miR-607	CLIP-seq
MIRT2318121	hsa-miR-656	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT2393857	hsa-miR-3680	CLIP-seq
MIRT2393858	hsa-miR-4420	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT2093590	hsa-miR-548ae	CLIP-seq
MIRT2093591	hsa-miR-548aj	CLIP-seq
MIRT2093592	hsa-miR-548am	CLIP-seq
MIRT2093594	hsa-miR-548x	CLIP-seq
MIRT1314699	hsa-miR-628-5p	CLIP-seq
MIRT2393859	hsa-miR-642b	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318102	hsa-miR-1284	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT2613879	hsa-miR-202	CLIP-seq
MIRT2613880	hsa-miR-203	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT2613881	hsa-miR-3145-3p	CLIP-seq
MIRT2613882	hsa-miR-3150b-3p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT2613883	hsa-miR-3647-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314660	hsa-miR-371-5p	CLIP-seq
MIRT1314661	hsa-miR-371b-5p	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT2613884	hsa-miR-4678	CLIP-seq
MIRT2613885	hsa-miR-4689	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2613886	hsa-miR-4784	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT2613887	hsa-miR-487a	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2613888	hsa-miR-513a-3p	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT2613889	hsa-miR-590-3p	CLIP-seq
MIRT2393859	hsa-miR-642b	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT2613890	hsa-miR-944	CLIP-seq
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT2613879	hsa-miR-202	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT2613881	hsa-miR-3145-3p	CLIP-seq
MIRT2613882	hsa-miR-3150b-3p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT2613884	hsa-miR-4678	CLIP-seq
MIRT2613885	hsa-miR-4689	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2613886	hsa-miR-4784	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT2613887	hsa-miR-487a	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq

Show/Hide all(138)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	ISS
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003383	Process	Apical constriction	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10652353, 11018042, 18694941, 19036714, 23093407
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	27853422
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	8798490
GO:0005515	Function	Protein binding	IPI	10652353, 14660612, 17853893, 20230755, 21281639, 22085929, 23093407, 25416956, 25448675, 27853422, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0006939	Process	Smooth muscle contraction	TAS	12778124
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	12082081
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10436159
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IGI	27160703
GO:0007266	Process	Rho protein signal transduction	TAS	8798490
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010494	Component	Cytoplasmic stress granule	IBA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0010508	Process	Positive regulation of autophagy	IGI	27853422
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IMP	28679962
GO:0010628	Process	Positive regulation of gene expression	IMP	27853422, 28679962
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	19181962
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	18573880
GO:0022614	Process	Membrane to membrane docking	IDA	12082081
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030036	Process	Actin cytoskeleton organization	TAS	10436159
GO:0030155	Process	Regulation of cell adhesion	TAS	12778124
GO:0030334	Process	Regulation of cell migration	IDA	23093407
GO:0030866	Process	Cortical actin cytoskeleton organization	IBA
GO:0031032	Process	Actomyosin structure organization	IBA
GO:0031175	Process	Neuron projection development	IGI	27160703
GO:0031267	Function	Small GTPase binding	IEA
GO:0032059	Component	Bleb	IEA
GO:0032060	Process	Bleb assembly	IEA
GO:0032091	Process	Negative regulation of protein binding	IDA	18573880
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	25911094
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	12778124
GO:0032970	Process	Regulation of actin filament-based process	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035556	Process	Intracellular signal transduction	IMP	27221467
GO:0042995	Component	Cell projection	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	28679962
GO:0045616	Process	Regulation of keratinocyte differentiation	IEA
GO:0045616	Process	Regulation of keratinocyte differentiation	IMP	19997641
GO:0045664	Process	Regulation of neuron differentiation	IGI	27160703
GO:0045937	Process	Positive regulation of phosphate metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048598	Process	Embryonic morphogenesis	IBA
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050900	Process	Leukocyte migration	IDA	12082081
GO:0050901	Process	Leukocyte tethering or rolling	IDA	12082081
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	TAS	27853422
GO:0051451	Process	Myoblast migration	IEA
GO:0051451	Process	Myoblast migration	ISS
GO:0051492	Process	Regulation of stress fiber assembly	IEA
GO:0051492	Process	Regulation of stress fiber assembly	TAS	12778124
GO:0051893	Process	Regulation of focal adhesion assembly	IEA
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	12778124
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	ISS
GO:0061157	Process	MRNA destabilization	IEA
GO:0061157	Process	MRNA destabilization	ISS
GO:0070168	Process	Negative regulation of biomineral tissue development	ISS
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IDA	23093407
GO:0071559	Process	Response to transforming growth factor beta	IEA
GO:0071559	Process	Response to transforming growth factor beta	ISS
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IBA
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IDA	18573880
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	IGI	25816133
GO:0072659	Process	Protein localization to plasma membrane	IMP	25816133
GO:0090128	Process	Regulation of synapse maturation	IEA
GO:0090521	Process	Podocyte cell migration	IEA
GO:0090521	Process	Podocyte cell migration	ISS
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	ISS
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110061	Process	Regulation of angiotensin-activated signaling pathway	IMP	28679962
GO:0140058	Process	Neuron projection arborization	IGI	27160703
GO:1900223	Process	Positive regulation of amyloid-beta clearance	IGI	27853422
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IGI	27160703
GO:1901888	Process	Regulation of cell junction assembly	IBA
GO:1902003	Process	Regulation of amyloid-beta formation	IEA
GO:1902430	Process	Negative regulation of amyloid-beta formation	IMP	24305806, 27853422
GO:1902992	Process	Negative regulation of amyloid precursor protein catabolic process	IMP	24305806, 27853422
GO:1903140	Process	Regulation of establishment of endothelial barrier	IEA
GO:1903140	Process	Regulation of establishment of endothelial barrier	IGI	25816133
GO:1903140	Process	Regulation of establishment of endothelial barrier	IMP	25816133
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IEA
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IGI	25816133
GO:1905205	Process	Positive regulation of connective tissue replacement	IMP	28679962
GO:1990776	Process	Response to angiotensin	IEA
GO:1990776	Process	Response to angiotensin	ISS
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	TAS	20803696
GO:2000145	Process	Regulation of cell motility	TAS	12778124
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	IEA

MIM	HGNC	e!Ensembl
601702	10251	ENSG00000067900

Protein

UniProt ID

Q13464

Protein name

Rho-associated protein kinase 1 (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-35) (Rho-associated, coiled-coil-containing protein kinase 1) (Rho-associated, coiled-coil-containing protein kinase I) (ROCK-I) (p160 ROCK-1) (p160ROCK)

Protein function

Protein kinase which is a key regulator of the actin cytoskeleton and cell polarity (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579). Involved

PDB

1S1C , 2ESM , 2ETK , 2ETR , 2V55 , 3D9V , 3NCZ , 3NDM , 3O0Z , 3TV7 , 3TWJ , 3V8S , 4L2W , 4W7P , 4YVC , 4YVE , 5BML , 5F5P , 5HVU , 5KKS , 5KKT , 5UZJ , 5WNE , 5WNF , 5WNG , 5WNH , 6E9W , 7JOU , 7S25 , 7S26 , 8P0S , 8ZH5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	76 → 338	Protein kinase domain	Domain
PF08912	Rho_Binding	948 → 1014	Rho Binding	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Detected in blood platelets. {ECO:0000269|PubMed:8617235}.

Sequence

MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS

Sequence length

1354

Interactions

View interactions

ROCK1 (Rho associated coiled-coil containing protein kinase 1)