Gene Gene information from NCBI Gene database.
Entrez ID 6048
Gene name Ring finger protein 5
Gene symbol RNF5
Synonyms (NCBI Gene)
RING5RMA1
Chromosome 6
Chromosome location 6p21.32
Summary The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and alter
miRNA miRNA information provided by mirtarbase database.
130
miRTarBase ID miRNA Experiments Reference
MIRT042288 hsa-miR-484 CLASH 23622248
MIRT1313522 hsa-let-7a CLIP-seq
MIRT1313523 hsa-let-7b CLIP-seq
MIRT1313524 hsa-let-7c CLIP-seq
MIRT1313525 hsa-let-7d CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
39
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IDA 19269966
GO:0005515 Function Protein binding IPI 12861019, 14667819, 16901789, 19269966, 19549727, 20152160, 24019521, 25416956, 25759021, 26618866, 31515488, 32296183, 32814053, 33961781, 36012204
GO:0005739 Component Mitochondrion IEA
GO:0005783 Component Endoplasmic reticulum IDA
GO:0005783 Component Endoplasmic reticulum IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602677 10068 ENSG00000204308
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99942
Protein name E3 ubiquitin-protein ligase RNF5 (EC 2.3.2.27) (RING finger protein 5) (Ram1 homolog) (HsRma1)
Protein function Membrane-bound E3 ubiquitin-protein ligase that mediates ubiquitination of target proteins (PubMed:11329381, PubMed:12861019, PubMed:16176924, PubMed:19269966, PubMed:19285439). May function together with E2 ubiquitin-conjugating enzymes UBE2D1/
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13920 zf-C3HC4_3 23 73 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9533025}.
Sequence
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISR
EKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Sequence length 180
Interactions View interactions