Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6048
Gene name Gene Name - the full gene name approved by the HGNC.	Ring finger protein 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RNF5
Synonyms (NCBI Gene) Gene synonyms aliases	RING5, RMA1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and alter

Show/Hide all(130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042288	hsa-miR-484	CLASH	23622248
MIRT1313522	hsa-let-7a	CLIP-seq
MIRT1313523	hsa-let-7b	CLIP-seq
MIRT1313524	hsa-let-7c	CLIP-seq
MIRT1313525	hsa-let-7d	CLIP-seq
MIRT1313526	hsa-let-7e	CLIP-seq
MIRT1313527	hsa-let-7f	CLIP-seq
MIRT1313528	hsa-let-7g	CLIP-seq
MIRT1313529	hsa-let-7i	CLIP-seq
MIRT1313530	hsa-miR-151-3p	CLIP-seq
MIRT1313531	hsa-miR-1915	CLIP-seq
MIRT1313532	hsa-miR-196a	CLIP-seq
MIRT1313533	hsa-miR-196b	CLIP-seq
MIRT1313534	hsa-miR-200b	CLIP-seq
MIRT1313535	hsa-miR-200c	CLIP-seq
MIRT1313536	hsa-miR-214	CLIP-seq
MIRT1313537	hsa-miR-2355-5p	CLIP-seq
MIRT1313538	hsa-miR-298	CLIP-seq
MIRT1313539	hsa-miR-3121-3p	CLIP-seq
MIRT1313540	hsa-miR-3123	CLIP-seq
MIRT1313541	hsa-miR-3149	CLIP-seq
MIRT1313542	hsa-miR-3150a-3p	CLIP-seq
MIRT1313543	hsa-miR-3173-3p	CLIP-seq
MIRT1313544	hsa-miR-3174	CLIP-seq
MIRT1313545	hsa-miR-3175	CLIP-seq
MIRT1313546	hsa-miR-3180	CLIP-seq
MIRT1313547	hsa-miR-3180-3p	CLIP-seq
MIRT1313548	hsa-miR-3184	CLIP-seq
MIRT1313549	hsa-miR-3196	CLIP-seq
MIRT1313550	hsa-miR-3202	CLIP-seq
MIRT1313551	hsa-miR-326	CLIP-seq
MIRT1313552	hsa-miR-330-5p	CLIP-seq
MIRT1313553	hsa-miR-3619-5p	CLIP-seq
MIRT1313554	hsa-miR-3667-3p	CLIP-seq
MIRT1313555	hsa-miR-3919	CLIP-seq
MIRT1313556	hsa-miR-3921	CLIP-seq
MIRT1313557	hsa-miR-423-5p	CLIP-seq
MIRT1313558	hsa-miR-429	CLIP-seq
MIRT1313559	hsa-miR-4291	CLIP-seq
MIRT1313560	hsa-miR-4303	CLIP-seq
MIRT1313561	hsa-miR-4426	CLIP-seq
MIRT1313562	hsa-miR-4433	CLIP-seq
MIRT1313563	hsa-miR-4436b-3p	CLIP-seq
MIRT1313564	hsa-miR-4458	CLIP-seq
MIRT1313565	hsa-miR-4468	CLIP-seq
MIRT1313566	hsa-miR-4488	CLIP-seq
MIRT1313567	hsa-miR-4500	CLIP-seq
MIRT1313568	hsa-miR-4522	CLIP-seq
MIRT1313569	hsa-miR-4647	CLIP-seq
MIRT1313570	hsa-miR-4653-5p	CLIP-seq
MIRT1313571	hsa-miR-4662b	CLIP-seq
MIRT1313572	hsa-miR-4667-5p	CLIP-seq
MIRT1313573	hsa-miR-4685-5p	CLIP-seq
MIRT1313574	hsa-miR-4697-5p	CLIP-seq
MIRT1313575	hsa-miR-4700-5p	CLIP-seq
MIRT1313576	hsa-miR-4765	CLIP-seq
MIRT1313577	hsa-miR-615-5p	CLIP-seq
MIRT1313578	hsa-miR-637	CLIP-seq
MIRT1313579	hsa-miR-665	CLIP-seq
MIRT1313580	hsa-miR-761	CLIP-seq
MIRT1313581	hsa-miR-921	CLIP-seq
MIRT1313582	hsa-miR-922	CLIP-seq
MIRT1313583	hsa-miR-939	CLIP-seq
MIRT1313584	hsa-miR-98	CLIP-seq
MIRT2093361	hsa-miR-149	CLIP-seq
MIRT2093362	hsa-miR-3064-5p	CLIP-seq
MIRT2093363	hsa-miR-3135b	CLIP-seq
MIRT1313542	hsa-miR-3150a-3p	CLIP-seq
MIRT2093364	hsa-miR-3166	CLIP-seq
MIRT1313545	hsa-miR-3175	CLIP-seq
MIRT1313551	hsa-miR-326	CLIP-seq
MIRT1313552	hsa-miR-330-5p	CLIP-seq
MIRT2093365	hsa-miR-3652	CLIP-seq
MIRT2093366	hsa-miR-3689d	CLIP-seq
MIRT2093367	hsa-miR-4257	CLIP-seq
MIRT2093368	hsa-miR-4430	CLIP-seq
MIRT2093369	hsa-miR-4505	CLIP-seq
MIRT2093370	hsa-miR-4659a-3p	CLIP-seq
MIRT2093371	hsa-miR-4659b-3p	CLIP-seq
MIRT2093372	hsa-miR-4794	CLIP-seq
MIRT2093373	hsa-miR-541	CLIP-seq
MIRT2093374	hsa-miR-654-5p	CLIP-seq
MIRT1313583	hsa-miR-939	CLIP-seq
MIRT2093375	hsa-miR-942	CLIP-seq
MIRT2317899	hsa-miR-1224-3p	CLIP-seq
MIRT1313531	hsa-miR-1915	CLIP-seq
MIRT1313534	hsa-miR-200b	CLIP-seq
MIRT1313535	hsa-miR-200c	CLIP-seq
MIRT1313537	hsa-miR-2355-5p	CLIP-seq
MIRT2093362	hsa-miR-3064-5p	CLIP-seq
MIRT1313540	hsa-miR-3123	CLIP-seq
MIRT2093363	hsa-miR-3135b	CLIP-seq
MIRT2317900	hsa-miR-3617	CLIP-seq
MIRT2093365	hsa-miR-3652	CLIP-seq
MIRT1313554	hsa-miR-3667-3p	CLIP-seq
MIRT2093366	hsa-miR-3689d	CLIP-seq
MIRT1313555	hsa-miR-3919	CLIP-seq
MIRT2093367	hsa-miR-4257	CLIP-seq
MIRT2317901	hsa-miR-4271	CLIP-seq
MIRT1313558	hsa-miR-429	CLIP-seq
MIRT2093368	hsa-miR-4430	CLIP-seq
MIRT1313562	hsa-miR-4433	CLIP-seq
MIRT1313563	hsa-miR-4436b-3p	CLIP-seq
MIRT2317902	hsa-miR-4471	CLIP-seq
MIRT2093369	hsa-miR-4505	CLIP-seq
MIRT1313573	hsa-miR-4685-5p	CLIP-seq
MIRT2317903	hsa-miR-4699-5p	CLIP-seq
MIRT2317904	hsa-miR-4709-3p	CLIP-seq
MIRT2317905	hsa-miR-4725-3p	CLIP-seq
MIRT2317906	hsa-miR-4768-5p	CLIP-seq
MIRT2093373	hsa-miR-541	CLIP-seq
MIRT1313577	hsa-miR-615-5p	CLIP-seq
MIRT2317907	hsa-miR-641	CLIP-seq
MIRT2093374	hsa-miR-654-5p	CLIP-seq
MIRT1313579	hsa-miR-665	CLIP-seq
MIRT2093361	hsa-miR-149	CLIP-seq
MIRT2093362	hsa-miR-3064-5p	CLIP-seq
MIRT2093363	hsa-miR-3135b	CLIP-seq
MIRT1313551	hsa-miR-326	CLIP-seq
MIRT1313552	hsa-miR-330-5p	CLIP-seq
MIRT2093365	hsa-miR-3652	CLIP-seq
MIRT2093366	hsa-miR-3689d	CLIP-seq
MIRT2093368	hsa-miR-4430	CLIP-seq
MIRT2093369	hsa-miR-4505	CLIP-seq
MIRT2093370	hsa-miR-4659a-3p	CLIP-seq
MIRT2093371	hsa-miR-4659b-3p	CLIP-seq
MIRT2093372	hsa-miR-4794	CLIP-seq
MIRT2093373	hsa-miR-541	CLIP-seq
MIRT2093374	hsa-miR-654-5p	CLIP-seq
MIRT2093375	hsa-miR-942	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19269966
GO:0005515	Function	Protein binding	IPI	12861019, 14667819, 16901789, 19269966, 19549727, 20152160, 24019521, 25416956, 25759021, 31515488, 32296183, 32814053
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0008270	Function	Zinc ion binding	TAS	9533025
GO:0009617	Process	Response to bacterium	IEA
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IGI	24019521
GO:0031648	Process	Protein destabilization	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0036503	Process	ERAD pathway	IMP	24019521
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0044257	Process	Cellular protein catabolic process	IMP	19285439
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0044390	Function	Ubiquitin-like protein conjugating enzyme binding	IBA	21873635
GO:0044877	Function	Protein-containing complex binding	IPI	24019521
GO:0055085	Process	Transmembrane transport	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	TAS	24019521
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	19269966
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	19285439
GO:0071712	Process	ER-associated misfolded protein catabolic process	IBA	21873635
GO:0071712	Process	ER-associated misfolded protein catabolic process	IMP	19269966
GO:1904380	Process	Endoplasmic reticulum mannose trimming	TAS
GO:2000785	Process	Regulation of autophagosome assembly	IEA

MIM	HGNC	e!Ensembl
602677	10068	ENSG00000204308

Protein

UniProt ID

Q99942

Protein name

E3 ubiquitin-protein ligase RNF5 (EC 2.3.2.27) (RING finger protein 5) (Ram1 homolog) (HsRma1)

Protein function

Membrane-bound E3 ubiquitin-protein ligase that mediates ubiquitination of target proteins (PubMed:11329381, PubMed:12861019, PubMed:16176924, PubMed:19269966, PubMed:19285439). May function together with E2 ubiquitin-conjugating enzymes UBE2D1/

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13920	zf-C3HC4_3	23 → 73		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9533025}.

Sequence

MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Sequence length

180

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Dental caries	Dental caries	GWAS
Takayasu Arteritis	Takayasu Arteritis	GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	26356813
Breast Neoplasms	Associate	17804730, 37816703
Carcinogenesis	Associate	36656913
Carcinoma Hepatocellular	Associate	29514927, 32054686
Chronobiology Disorders	Associate	37635482
Cystic Fibrosis	Associate	19625452, 37440686
Cystic Fibrosis	Inhibit	31746734
Inflammation	Inhibit	37635482
Leukemia	Associate	17804730
Lymphoma Primary Effusion	Associate	36656913
Melanoma	Stimulate	17804730
Mitochondrial Diseases	Inhibit	37635482
Neoplasms	Associate	17804730, 36656913
Neoplasms	Inhibit	37816703
Newcastle Disease	Associate	31270229
Osteoglophonic dwarfism	Inhibit	37635482
Ovarian Neoplasms	Associate	17804730
Ring Chromosome 20 Syndrome	Inhibit	37635482

RNF5 (ring finger protein 5)