Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6048
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF5
Synonyms (NCBI Gene) Gene synonyms aliases
RING5, RMA1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and alter
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042288 hsa-miR-484 CLASH 23622248
MIRT1313522 hsa-let-7a CLIP-seq
MIRT1313523 hsa-let-7b CLIP-seq
MIRT1313524 hsa-let-7c CLIP-seq
MIRT1313525 hsa-let-7d CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IDA 19269966
GO:0005515 Function Protein binding IPI 12861019, 14667819, 16901789, 19269966, 19549727, 20152160, 24019521, 25416956, 25759021, 26618866, 31515488, 32296183, 32814053, 33961781, 36012204
GO:0005739 Component Mitochondrion IEA
GO:0005783 Component Endoplasmic reticulum IDA
GO:0005783 Component Endoplasmic reticulum IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602677 10068 ENSG00000204308
Protein
UniProt ID Q99942
Protein name E3 ubiquitin-protein ligase RNF5 (EC 2.3.2.27) (RING finger protein 5) (Ram1 homolog) (HsRma1)
Protein function Membrane-bound E3 ubiquitin-protein ligase that mediates ubiquitination of target proteins (PubMed:11329381, PubMed:12861019, PubMed:16176924, PubMed:19269966, PubMed:19285439). May function together with E2 ubiquitin-conjugating enzymes UBE2D1/
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13920 zf-C3HC4_3 23 73 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9533025}.
Sequence
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISR
EKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Sequence length 180
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dental caries Dental caries N/A N/A GWAS
Takayasu Arteritis Takayasu arteritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26356813
Breast Neoplasms Associate 17804730, 37816703
Carcinogenesis Associate 36656913
Carcinoma Hepatocellular Associate 29514927, 32054686
Chronobiology Disorders Associate 37635482
Cystic Fibrosis Associate 19625452, 37440686
Cystic Fibrosis Inhibit 31746734
Inflammation Inhibit 37635482
Leukemia Associate 17804730
Lymphoma Primary Effusion Associate 36656913