Gene Gene information from NCBI Gene database.
Entrez ID 5970
Gene name RELA proto-oncogene, NF-kB subunit
Gene symbol RELA
Synonyms (NCBI Gene)
AIF3BL3CMCUNFKB3p65
Chromosome 11
Chromosome location 11q13.1
Summary NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcripti
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs1565191003 C>T Pathogenic Splice donor variant
rs1590931704 T>G Likely-pathogenic Splice acceptor variant, intron variant
miRNA miRNA information provided by mirtarbase database.
151
miRTarBase ID miRNA Experiments Reference
MIRT002616 hsa-miR-124-3p Luciferase reporter assayMicroarray 15685193
MIRT002531 hsa-miR-373-3p Microarray 15685193
MIRT002531 hsa-miR-373-3p Microarray;Other 15685193
MIRT002616 hsa-miR-124-3p Microarray;Other 15685193
MIRT025722 hsa-miR-7-5p Sequencing 20371350
Transcription factors Transcription factors information provided by TRRUST V2 database.
28
Transcription factor Regulation Reference
APEX1 Activation 17045925
AR Repression 18386814
ATF2 Activation 21350211
BCL3 Unknown 7896265
EP300 Unknown 21146504
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
210
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 17350185
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IC 1406630
GO:0000785 Component Chromatin IDA 1406630, 8413223, 38114488
GO:0000785 Component Chromatin IDA 21343296, 26268439
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
164014 9955 ENSG00000173039
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q04206
Protein name Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)
Protein function NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammati
PDB 1NFI , 2LSP , 2O61 , 3GUT , 3QXY , 3RC0 , 4KV1 , 4KV4 , 5U4K , 5URN , 6NV2 , 6QHL , 6QHM , 6YOW , 6YOX , 6YOY , 6YP2 , 6YP3 , 6YP8 , 6YPL , 6YPY , 6YQ2 , 7BI3 , 7BIQ , 7BIW , 7BIY , 7BJB , 7BJF , 7BJL , 7BJW , 7BKH , 7LET , 7LEU , 7LF4 , 7NJ9 , 7NJB , 7NK3 , 7NK5 , 7NLA , 7NLE , 7NM1 , 7NM3 , 7NM9 , 7NMH , 7NQP , 7NR7 , 7NSV , 7NV4 , 7NVI , 7NWS , 7NXS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00554 RHD_DNA_bind 21 186 Rel homology DNA-binding domain Domain
PF16179 RHD_dimer 195 292 Rel homology dimerisation domain Domain
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDN
RAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDT
DDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
Sequence length 551
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
40
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Childhood-onset schizophrenia Likely pathogenic rs863223356 RCV000202330
Mucocutaneous ulceration Likely pathogenic rs1590931704 RCV000853280
Mucocutaneous ulceration, chronic Pathogenic; Likely pathogenic rs2496824516, rs2496833014, rs2496827835, rs749716796, rs1565191003, rs1326268854 RCV003159249
RCV003159250
RCV003494566
RCV003994785
RCV000754619
RCV003147591
RELA-related disorder Likely pathogenic; Pathogenic rs2496867941, rs1856484601 RCV003894623
RCV003396687
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Uncertain significance rs2135573626 RCV005925472
Gastric cancer Uncertain significance rs12721571 RCV005923953
Lung cancer Likely benign rs1565188326 RCV005931593
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Associate 25504433
Acute Disease Associate 19079204
Acute Kidney Injury Stimulate 24607031
Acute Lung Injury Associate 31054328, 35269738
Adenocarcinoma Associate 15256061
Adenocarcinoma Stimulate 22384099
Adenocarcinoma of Lung Associate 25820700, 32873769, 35379924
Alcoholic Intoxication Inhibit 17895971
Alcoholism Associate 17895971
Alcoholism Stimulate 36577732