Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5914
Gene name Gene Name - the full gene name approved by the HGNC.	Retinoic acid receptor alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RARA
Synonyms (NCBI Gene) Gene synonyms aliases	NR1B1, RAR, RARalpha
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulo

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs786205678	C>T	Drug-response	Missense variant, coding sequence variant
rs1555574254	TCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCGTGAC>-	Drug-response	Terminator codon variant, 3 prime UTR variant, stop lost, inframe indel

Show/Hide all(413)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004389	hsa-miR-125a-5p	Microarray, Northern blot	16331254
MIRT024237	hsa-miR-218-5p	Sequencing	20371350
MIRT045829	hsa-miR-138-5p	CLASH	23622248
MIRT039873	hsa-miR-615-3p	CLASH	23622248
MIRT469581	hsa-miR-3714	PAR-CLIP	23592263
MIRT469582	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT469580	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT469579	hsa-miR-940	PAR-CLIP	23592263
MIRT469578	hsa-miR-1321	PAR-CLIP	23592263
MIRT469577	hsa-miR-4739	PAR-CLIP	23592263
MIRT469576	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT469575	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT469574	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT469573	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT469572	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT469571	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT469570	hsa-miR-4419a	PAR-CLIP	23592263
MIRT469569	hsa-miR-4510	PAR-CLIP	23592263
MIRT469568	hsa-miR-6127	PAR-CLIP	23592263
MIRT469567	hsa-miR-6129	PAR-CLIP	23592263
MIRT469566	hsa-miR-6130	PAR-CLIP	23592263
MIRT469565	hsa-miR-6133	PAR-CLIP	23592263
MIRT469564	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT469563	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT469562	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT469560	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT469561	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT469559	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT469558	hsa-miR-4271	PAR-CLIP	23592263
MIRT469557	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT469556	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT469555	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT469554	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT469553	hsa-miR-515-5p	PAR-CLIP	23592263
MIRT469552	hsa-miR-519e-5p	PAR-CLIP	23592263
MIRT469551	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT469550	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT469549	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT469548	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT469547	hsa-miR-3689c	PAR-CLIP	23592263
MIRT469546	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT469545	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT045829	hsa-miR-138-5p	Luciferase reporter assay, Western blot	25680531
MIRT045829	hsa-miR-138-5p	Luciferase reporter assay, Western blot	25680531
MIRT734634	hsa-miR-146b-3p	qRT-PCR	34009317
MIRT045829	hsa-miR-138-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33935126
MIRT469581	hsa-miR-3714	PAR-CLIP	23592263
MIRT469582	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT469580	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT469579	hsa-miR-940	PAR-CLIP	23592263
MIRT469578	hsa-miR-1321	PAR-CLIP	23592263
MIRT469577	hsa-miR-4739	PAR-CLIP	23592263
MIRT469576	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT469575	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT469574	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT469573	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT469572	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT469571	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT469570	hsa-miR-4419a	PAR-CLIP	23592263
MIRT469569	hsa-miR-4510	PAR-CLIP	23592263
MIRT469568	hsa-miR-6127	PAR-CLIP	23592263
MIRT469567	hsa-miR-6129	PAR-CLIP	23592263
MIRT469566	hsa-miR-6130	PAR-CLIP	23592263
MIRT469565	hsa-miR-6133	PAR-CLIP	23592263
MIRT469564	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT469563	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT469562	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT469560	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT469561	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT469559	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT469558	hsa-miR-4271	PAR-CLIP	23592263
MIRT469557	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT469556	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT469555	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT469554	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT469553	hsa-miR-515-5p	PAR-CLIP	23592263
MIRT469552	hsa-miR-519e-5p	PAR-CLIP	23592263
MIRT469551	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT469550	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT469549	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT469548	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT469547	hsa-miR-3689c	PAR-CLIP	23592263
MIRT469546	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT469545	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT1291428	hsa-miR-1207-3p	CLIP-seq
MIRT1291429	hsa-miR-1207-5p	CLIP-seq
MIRT1291430	hsa-miR-1245b-5p	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291432	hsa-miR-1252	CLIP-seq
MIRT1291433	hsa-miR-1275	CLIP-seq
MIRT1291434	hsa-miR-1278	CLIP-seq
MIRT1291435	hsa-miR-128	CLIP-seq
MIRT1291436	hsa-miR-1282	CLIP-seq
MIRT1291437	hsa-miR-1291	CLIP-seq
MIRT1291438	hsa-miR-1302	CLIP-seq
MIRT1291439	hsa-miR-138	CLIP-seq
MIRT1291440	hsa-miR-147	CLIP-seq
MIRT1291441	hsa-miR-151-5p	CLIP-seq
MIRT1291442	hsa-miR-151b	CLIP-seq
MIRT1291443	hsa-miR-1539	CLIP-seq
MIRT1291444	hsa-miR-1825	CLIP-seq
MIRT1291445	hsa-miR-1827	CLIP-seq
MIRT1291446	hsa-miR-183	CLIP-seq
MIRT1291447	hsa-miR-1909	CLIP-seq
MIRT1291448	hsa-miR-198	CLIP-seq
MIRT1291449	hsa-miR-199a-5p	CLIP-seq
MIRT1291450	hsa-miR-199b-5p	CLIP-seq
MIRT1291451	hsa-miR-205	CLIP-seq
MIRT1291452	hsa-miR-218	CLIP-seq
MIRT1291453	hsa-miR-27a	CLIP-seq
MIRT1291454	hsa-miR-27b	CLIP-seq
MIRT1291455	hsa-miR-296-5p	CLIP-seq
MIRT1291456	hsa-miR-299-3p	CLIP-seq
MIRT1291457	hsa-miR-3127-3p	CLIP-seq
MIRT1291458	hsa-miR-3142	CLIP-seq
MIRT1291459	hsa-miR-3150a-3p	CLIP-seq
MIRT1291460	hsa-miR-3160-3p	CLIP-seq
MIRT1291461	hsa-miR-3170	CLIP-seq
MIRT1291462	hsa-miR-3173-3p	CLIP-seq
MIRT1291463	hsa-miR-3175	CLIP-seq
MIRT1291464	hsa-miR-3179	CLIP-seq
MIRT1291465	hsa-miR-3181	CLIP-seq
MIRT1291466	hsa-miR-3184	CLIP-seq
MIRT1291467	hsa-miR-3193	CLIP-seq
MIRT1291468	hsa-miR-3194-3p	CLIP-seq
MIRT1291469	hsa-miR-3194-5p	CLIP-seq
MIRT1291470	hsa-miR-3202	CLIP-seq
MIRT1291471	hsa-miR-323b-3p	CLIP-seq
MIRT1291472	hsa-miR-331-3p	CLIP-seq
MIRT1291473	hsa-miR-342-5p	CLIP-seq
MIRT1291474	hsa-miR-3612	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291476	hsa-miR-3616-3p	CLIP-seq
MIRT1291477	hsa-miR-3646	CLIP-seq
MIRT1291478	hsa-miR-3662	CLIP-seq
MIRT1291479	hsa-miR-3675-5p	CLIP-seq
MIRT1291480	hsa-miR-374c	CLIP-seq
MIRT1291481	hsa-miR-3919	CLIP-seq
MIRT1291482	hsa-miR-3939	CLIP-seq
MIRT1291483	hsa-miR-3978	CLIP-seq
MIRT1291484	hsa-miR-423-5p	CLIP-seq
MIRT1291485	hsa-miR-4265	CLIP-seq
MIRT1291486	hsa-miR-4267	CLIP-seq
MIRT1291487	hsa-miR-4296	CLIP-seq
MIRT1291488	hsa-miR-4298	CLIP-seq
MIRT1291489	hsa-miR-4299	CLIP-seq
MIRT1291490	hsa-miR-4302	CLIP-seq
MIRT1291491	hsa-miR-4322	CLIP-seq
MIRT1291492	hsa-miR-4417	CLIP-seq
MIRT1291493	hsa-miR-4428	CLIP-seq
MIRT1291494	hsa-miR-4435	CLIP-seq
MIRT1291495	hsa-miR-4447	CLIP-seq
MIRT1291496	hsa-miR-4456	CLIP-seq
MIRT1291497	hsa-miR-4467	CLIP-seq
MIRT1291498	hsa-miR-4472	CLIP-seq
MIRT1291499	hsa-miR-4487	CLIP-seq
MIRT1291500	hsa-miR-4488	CLIP-seq
MIRT1291501	hsa-miR-4492	CLIP-seq
MIRT1291502	hsa-miR-4498	CLIP-seq
MIRT1291503	hsa-miR-4505	CLIP-seq
MIRT1291504	hsa-miR-4508	CLIP-seq
MIRT1291505	hsa-miR-4648	CLIP-seq
MIRT1291506	hsa-miR-4649-3p	CLIP-seq
MIRT1291507	hsa-miR-4650-3p	CLIP-seq
MIRT1291508	hsa-miR-4650-5p	CLIP-seq
MIRT1291509	hsa-miR-4651	CLIP-seq
MIRT1291510	hsa-miR-4660	CLIP-seq
MIRT1291511	hsa-miR-4664-5p	CLIP-seq
MIRT1291512	hsa-miR-4665-5p	CLIP-seq
MIRT1291513	hsa-miR-4667-5p	CLIP-seq
MIRT1291514	hsa-miR-4672	CLIP-seq
MIRT1291515	hsa-miR-4697-5p	CLIP-seq
MIRT1291516	hsa-miR-4699-5p	CLIP-seq
MIRT1291517	hsa-miR-4700-5p	CLIP-seq
MIRT1291518	hsa-miR-4706	CLIP-seq
MIRT1291519	hsa-miR-4710	CLIP-seq
MIRT1291520	hsa-miR-4716-5p	CLIP-seq
MIRT1291521	hsa-miR-4717-3p	CLIP-seq
MIRT1291522	hsa-miR-4719	CLIP-seq
MIRT1291523	hsa-miR-4720-3p	CLIP-seq
MIRT1291524	hsa-miR-4721	CLIP-seq
MIRT1291525	hsa-miR-4728-5p	CLIP-seq
MIRT1291526	hsa-miR-4731-5p	CLIP-seq
MIRT1291527	hsa-miR-4732-3p	CLIP-seq
MIRT1291528	hsa-miR-4734	CLIP-seq
MIRT1291529	hsa-miR-4736	CLIP-seq
MIRT1291530	hsa-miR-4747-3p	CLIP-seq
MIRT1291531	hsa-miR-4749-5p	CLIP-seq
MIRT1291532	hsa-miR-4757-5p	CLIP-seq
MIRT1291533	hsa-miR-4763-3p	CLIP-seq
MIRT1291534	hsa-miR-4782-5p	CLIP-seq
MIRT1291535	hsa-miR-4787-5p	CLIP-seq
MIRT1291536	hsa-miR-4792	CLIP-seq
MIRT1291537	hsa-miR-4804-3p	CLIP-seq
MIRT1291538	hsa-miR-486-3p	CLIP-seq
MIRT1291539	hsa-miR-513a-5p	CLIP-seq
MIRT1291540	hsa-miR-548aa	CLIP-seq
MIRT1291541	hsa-miR-548an	CLIP-seq
MIRT1291542	hsa-miR-555	CLIP-seq
MIRT1291543	hsa-miR-558	CLIP-seq
MIRT1291544	hsa-miR-576-3p	CLIP-seq
MIRT1291545	hsa-miR-599	CLIP-seq
MIRT1291546	hsa-miR-608	CLIP-seq
MIRT1291547	hsa-miR-619	CLIP-seq
MIRT1291548	hsa-miR-636	CLIP-seq
MIRT1291549	hsa-miR-637	CLIP-seq
MIRT1291550	hsa-miR-650	CLIP-seq
MIRT1291551	hsa-miR-655	CLIP-seq
MIRT1291552	hsa-miR-711	CLIP-seq
MIRT1291553	hsa-miR-744	CLIP-seq
MIRT1291554	hsa-miR-762	CLIP-seq
MIRT1291555	hsa-miR-766	CLIP-seq
MIRT1291556	hsa-miR-933	CLIP-seq
MIRT1291557	hsa-miR-939	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291558	hsa-miR-1276	CLIP-seq
MIRT1291434	hsa-miR-1278	CLIP-seq
MIRT1291435	hsa-miR-128	CLIP-seq
MIRT1291559	hsa-miR-1470	CLIP-seq
MIRT1291560	hsa-miR-1913	CLIP-seq
MIRT1291561	hsa-miR-1915	CLIP-seq
MIRT1291562	hsa-miR-194	CLIP-seq
MIRT1291451	hsa-miR-205	CLIP-seq
MIRT1291452	hsa-miR-218	CLIP-seq
MIRT1291563	hsa-miR-2355-5p	CLIP-seq
MIRT1291453	hsa-miR-27a	CLIP-seq
MIRT1291454	hsa-miR-27b	CLIP-seq
MIRT1291564	hsa-miR-3150b-3p	CLIP-seq
MIRT1291565	hsa-miR-3153	CLIP-seq
MIRT1291566	hsa-miR-3189-5p	CLIP-seq
MIRT1291567	hsa-miR-3192	CLIP-seq
MIRT1291471	hsa-miR-323b-3p	CLIP-seq
MIRT1291568	hsa-miR-324-3p	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291477	hsa-miR-3646	CLIP-seq
MIRT1291569	hsa-miR-3647-3p	CLIP-seq
MIRT1291478	hsa-miR-3662	CLIP-seq
MIRT1291570	hsa-miR-3664-5p	CLIP-seq
MIRT1291571	hsa-miR-3929	CLIP-seq
MIRT1291483	hsa-miR-3978	CLIP-seq
MIRT1291572	hsa-miR-4264	CLIP-seq
MIRT1291573	hsa-miR-4311	CLIP-seq
MIRT1291574	hsa-miR-4314	CLIP-seq
MIRT1291575	hsa-miR-4328	CLIP-seq
MIRT1291576	hsa-miR-4419b	CLIP-seq
MIRT1291577	hsa-miR-4446-3p	CLIP-seq
MIRT1291578	hsa-miR-4449	CLIP-seq
MIRT1291579	hsa-miR-4469	CLIP-seq
MIRT1291580	hsa-miR-4478	CLIP-seq
MIRT1291581	hsa-miR-4532	CLIP-seq
MIRT1291582	hsa-miR-4646-5p	CLIP-seq
MIRT1291583	hsa-miR-4667-3p	CLIP-seq
MIRT1291584	hsa-miR-4668-5p	CLIP-seq
MIRT1291514	hsa-miR-4672	CLIP-seq
MIRT1291585	hsa-miR-4689	CLIP-seq
MIRT1291586	hsa-miR-4695-3p	CLIP-seq
MIRT1291587	hsa-miR-4709-5p	CLIP-seq
MIRT1291588	hsa-miR-4712-5p	CLIP-seq
MIRT1291522	hsa-miR-4719	CLIP-seq
MIRT1291523	hsa-miR-4720-3p	CLIP-seq
MIRT1291589	hsa-miR-4758-3p	CLIP-seq
MIRT1291590	hsa-miR-4784	CLIP-seq
MIRT1291591	hsa-miR-4797-3p	CLIP-seq
MIRT1291537	hsa-miR-4804-3p	CLIP-seq
MIRT1291592	hsa-miR-493	CLIP-seq
MIRT1291539	hsa-miR-513a-5p	CLIP-seq
MIRT1291593	hsa-miR-548a-3p	CLIP-seq
MIRT1291594	hsa-miR-548e	CLIP-seq
MIRT1291595	hsa-miR-548f	CLIP-seq
MIRT1291596	hsa-miR-552	CLIP-seq
MIRT1291597	hsa-miR-583	CLIP-seq
MIRT1291548	hsa-miR-636	CLIP-seq
MIRT1291598	hsa-miR-639	CLIP-seq
MIRT1291599	hsa-miR-764	CLIP-seq
MIRT1291600	hsa-miR-770-5p	CLIP-seq
MIRT1291601	hsa-miR-802	CLIP-seq
MIRT1291428	hsa-miR-1207-3p	CLIP-seq
MIRT1291429	hsa-miR-1207-5p	CLIP-seq
MIRT2086752	hsa-miR-1231	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291439	hsa-miR-138	CLIP-seq
MIRT1291440	hsa-miR-147	CLIP-seq
MIRT1291559	hsa-miR-1470	CLIP-seq
MIRT1291444	hsa-miR-1825	CLIP-seq
MIRT1291445	hsa-miR-1827	CLIP-seq
MIRT1291447	hsa-miR-1909	CLIP-seq
MIRT1291560	hsa-miR-1913	CLIP-seq
MIRT1291562	hsa-miR-194	CLIP-seq
MIRT1291449	hsa-miR-199a-5p	CLIP-seq
MIRT1291450	hsa-miR-199b-5p	CLIP-seq
MIRT1291563	hsa-miR-2355-5p	CLIP-seq
MIRT1291459	hsa-miR-3150a-3p	CLIP-seq
MIRT1291463	hsa-miR-3175	CLIP-seq
MIRT1291566	hsa-miR-3189-5p	CLIP-seq
MIRT1291568	hsa-miR-324-3p	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291479	hsa-miR-3675-5p	CLIP-seq
MIRT2086753	hsa-miR-3911	CLIP-seq
MIRT1291481	hsa-miR-3919	CLIP-seq
MIRT1291482	hsa-miR-3939	CLIP-seq
MIRT1291483	hsa-miR-3978	CLIP-seq
MIRT1291572	hsa-miR-4264	CLIP-seq
MIRT1291489	hsa-miR-4299	CLIP-seq
MIRT1291577	hsa-miR-4446-3p	CLIP-seq
MIRT1291579	hsa-miR-4469	CLIP-seq
MIRT2086754	hsa-miR-4480	CLIP-seq
MIRT1291500	hsa-miR-4488	CLIP-seq
MIRT1291507	hsa-miR-4650-3p	CLIP-seq
MIRT1291508	hsa-miR-4650-5p	CLIP-seq
MIRT1291583	hsa-miR-4667-3p	CLIP-seq
MIRT1291513	hsa-miR-4667-5p	CLIP-seq
MIRT1291586	hsa-miR-4695-3p	CLIP-seq
MIRT1291515	hsa-miR-4697-5p	CLIP-seq
MIRT1291517	hsa-miR-4700-5p	CLIP-seq
MIRT1291518	hsa-miR-4706	CLIP-seq
MIRT1291587	hsa-miR-4709-5p	CLIP-seq
MIRT1291588	hsa-miR-4712-5p	CLIP-seq
MIRT2086755	hsa-miR-4723-5p	CLIP-seq
MIRT1291526	hsa-miR-4731-5p	CLIP-seq
MIRT1291531	hsa-miR-4749-5p	CLIP-seq
MIRT1291532	hsa-miR-4757-5p	CLIP-seq
MIRT1291589	hsa-miR-4758-3p	CLIP-seq
MIRT1291533	hsa-miR-4763-3p	CLIP-seq
MIRT1291591	hsa-miR-4797-3p	CLIP-seq
MIRT1291541	hsa-miR-548an	CLIP-seq
MIRT1291596	hsa-miR-552	CLIP-seq
MIRT1291545	hsa-miR-599	CLIP-seq
MIRT1291549	hsa-miR-637	CLIP-seq
MIRT2086756	hsa-miR-644	CLIP-seq
MIRT1291553	hsa-miR-744	CLIP-seq
MIRT1291599	hsa-miR-764	CLIP-seq
MIRT1291600	hsa-miR-770-5p	CLIP-seq
MIRT1291601	hsa-miR-802	CLIP-seq
MIRT1291556	hsa-miR-933	CLIP-seq
MIRT2086757	hsa-miR-936	CLIP-seq
MIRT1291557	hsa-miR-939	CLIP-seq
MIRT1291428	hsa-miR-1207-3p	CLIP-seq
MIRT1291433	hsa-miR-1275	CLIP-seq
MIRT1291439	hsa-miR-138	CLIP-seq
MIRT1291560	hsa-miR-1913	CLIP-seq
MIRT1291562	hsa-miR-194	CLIP-seq
MIRT1291451	hsa-miR-205	CLIP-seq
MIRT1291452	hsa-miR-218	CLIP-seq
MIRT2311681	hsa-miR-3130-5p	CLIP-seq
MIRT1291462	hsa-miR-3173-3p	CLIP-seq
MIRT1291465	hsa-miR-3181	CLIP-seq
MIRT1291566	hsa-miR-3189-5p	CLIP-seq
MIRT1291471	hsa-miR-323b-3p	CLIP-seq
MIRT1291568	hsa-miR-324-3p	CLIP-seq
MIRT1291472	hsa-miR-331-3p	CLIP-seq
MIRT1291473	hsa-miR-342-5p	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291476	hsa-miR-3616-3p	CLIP-seq
MIRT1291477	hsa-miR-3646	CLIP-seq
MIRT1291478	hsa-miR-3662	CLIP-seq
MIRT2311682	hsa-miR-3928	CLIP-seq
MIRT1291483	hsa-miR-3978	CLIP-seq
MIRT1291572	hsa-miR-4264	CLIP-seq
MIRT1291486	hsa-miR-4267	CLIP-seq
MIRT1291489	hsa-miR-4299	CLIP-seq
MIRT1291577	hsa-miR-4446-3p	CLIP-seq
MIRT2086754	hsa-miR-4480	CLIP-seq
MIRT2311683	hsa-miR-4482	CLIP-seq
MIRT1291511	hsa-miR-4664-5p	CLIP-seq
MIRT1291512	hsa-miR-4665-5p	CLIP-seq
MIRT1291514	hsa-miR-4672	CLIP-seq
MIRT2311684	hsa-miR-4694-3p	CLIP-seq
MIRT1291586	hsa-miR-4695-3p	CLIP-seq
MIRT1291518	hsa-miR-4706	CLIP-seq
MIRT1291587	hsa-miR-4709-5p	CLIP-seq
MIRT1291588	hsa-miR-4712-5p	CLIP-seq
MIRT1291522	hsa-miR-4719	CLIP-seq
MIRT1291523	hsa-miR-4720-3p	CLIP-seq
MIRT1291524	hsa-miR-4721	CLIP-seq
MIRT1291526	hsa-miR-4731-5p	CLIP-seq
MIRT1291531	hsa-miR-4749-5p	CLIP-seq
MIRT1291589	hsa-miR-4758-3p	CLIP-seq
MIRT1291591	hsa-miR-4797-3p	CLIP-seq
MIRT2311685	hsa-miR-4802-5p	CLIP-seq
MIRT1291537	hsa-miR-4804-3p	CLIP-seq
MIRT1291538	hsa-miR-486-3p	CLIP-seq
MIRT1291539	hsa-miR-513a-5p	CLIP-seq
MIRT1291596	hsa-miR-552	CLIP-seq
MIRT2311686	hsa-miR-595	CLIP-seq
MIRT1291548	hsa-miR-636	CLIP-seq
MIRT1291549	hsa-miR-637	CLIP-seq
MIRT1291553	hsa-miR-744	CLIP-seq
MIRT1291599	hsa-miR-764	CLIP-seq
MIRT2311687	hsa-miR-765	CLIP-seq
MIRT1291600	hsa-miR-770-5p	CLIP-seq
MIRT1291601	hsa-miR-802	CLIP-seq
MIRT2086757	hsa-miR-936	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291559	hsa-miR-1470	CLIP-seq
MIRT1291561	hsa-miR-1915	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291486	hsa-miR-4267	CLIP-seq
MIRT1291579	hsa-miR-4469	CLIP-seq
MIRT2608018	hsa-miR-4640-3p	CLIP-seq
MIRT1291583	hsa-miR-4667-3p	CLIP-seq
MIRT1291534	hsa-miR-4782-5p	CLIP-seq
MIRT1291555	hsa-miR-766	CLIP-seq
MIRT1291557	hsa-miR-939	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291559	hsa-miR-1470	CLIP-seq
MIRT1291561	hsa-miR-1915	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291486	hsa-miR-4267	CLIP-seq
MIRT1291579	hsa-miR-4469	CLIP-seq
MIRT2608018	hsa-miR-4640-3p	CLIP-seq
MIRT1291583	hsa-miR-4667-3p	CLIP-seq
MIRT1291534	hsa-miR-4782-5p	CLIP-seq
MIRT1291555	hsa-miR-766	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
CRABP2	Activation	16166294
CREBBP	Unknown	21110951
ESR1	Activation	9626663
JUN	Repression	9377582
KLF4	Repression	19531492
SP1	Activation	9626663

Show/Hide all(138)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	2825025
GO:0000785	Component	Chromatin	IDA	17363140, 21131358
GO:0000785	Component	Chromatin	ISA
GO:0000900	Function	MRNA regulatory element binding translation repressor activity	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19917671
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	20080953, 21131358
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	28122350
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001217	Function	DNA-binding transcription repressor activity	IMP	28122350
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001223	Function	Transcription coactivator binding	IPI	17641689
GO:0001657	Process	Ureteric bud development	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0001889	Process	Liver development	IEA
GO:0001972	Function	Retinoic acid binding	IDA	2825025
GO:0002068	Process	Glandular epithelial cell development	IEA
GO:0003148	Process	Outflow tract septum morphogenesis	IEA
GO:0003417	Process	Growth plate cartilage development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	20080953
GO:0003700	Function	DNA-binding transcription factor activity	IDA	18922886, 20413580
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	2825025, 21131358
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IDA	19628791
GO:0005515	Function	Protein binding	IPI	9653119, 16189514, 16456540, 16606617, 16769902, 17363140, 17560333, 17641689, 18048326, 19345331, 19850744, 19917671, 19934264, 20080953, 20133701, 20211142, 20543827, 21478865, 21516116, 21988832, 22056876, 22351778, 23518351, 23693014, 24819975, 25036637, 25241761, 25303530, 2541
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18845237, 19917671, 20080953
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	IPI	9430642, 10698945, 20543827, 21152046
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	19850744
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	2825025
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006468	Process	Protein phosphorylation	IMP	16456540
GO:0007281	Process	Germ cell development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	20080953
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0019899	Function	Enzyme binding	IPI	9628876, 12039952
GO:0019904	Function	Protein domain specific binding	IPI	20413580
GO:0021766	Process	Hippocampus development	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030850	Process	Prostate gland development	IEA
GO:0030852	Process	Regulation of granulocyte differentiation	IEA
GO:0030853	Process	Negative regulation of granulocyte differentiation	IDA	19917671
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0031490	Function	Chromatin DNA binding	IDA	19917671
GO:0031641	Process	Regulation of myelination	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032526	Process	Response to retinoic acid	IMP	17538076
GO:0032689	Process	Negative regulation of type II interferon production	IDA	18416830
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	18416830
GO:0032736	Process	Positive regulation of interleukin-13 production	IDA	18416830
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	18416830
GO:0032754	Process	Positive regulation of interleukin-5 production	IDA	18416830
GO:0032991	Component	Protein-containing complex	IDA	19917671, 20080953
GO:0033189	Process	Response to vitamin A	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	1310351
GO:0042789	Process	MRNA transcription by RNA polymerase II	NAS	9430642
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043277	Process	Apoptotic cell clearance	IMP	19628791
GO:0043422	Function	Protein kinase B binding	IPI	16417524
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044323	Function	Retinoic acid-responsive element binding	IDA	19917671
GO:0045471	Process	Response to ethanol	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	IDA	18416830
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045787	Process	Positive regulation of cell cycle	IMP	20080953
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20080953
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18845237, 19850744, 20080953
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19628791
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9430642, 19850744, 19917671, 21131358
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20080953
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048027	Function	MRNA 5'-UTR binding	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IBA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	9267036
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	2825025, 19917671
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IMP	17538076
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051018	Function	Protein kinase A binding	IDA	20215566
GO:0051099	Process	Positive regulation of binding	IMP	20080953
GO:0051393	Function	Alpha-actinin binding	IPI	22351778
GO:0055012	Process	Ventricular cardiac muscle cell differentiation	IEA
GO:0060010	Process	Sertoli cell fate commitment	IEA
GO:0060173	Process	Limb development	IEA
GO:0060324	Process	Face development	IEA
GO:0060348	Process	Bone development	IEA
GO:0060534	Process	Trachea cartilage development	IEA
GO:0060591	Process	Chondroblast differentiation	IEA
GO:0061037	Process	Negative regulation of cartilage development	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071300	Process	Cellular response to retinoic acid	IMP	28122350
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	20080953
GO:0071630	Process	Nuclear protein quality control by the ubiquitin-proteasome system	IDA	37478846
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	1310351
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	9430642
GO:1901363	Function	Heterocyclic compound binding	IEA
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	28122350
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
180240	9864	ENSG00000131759

Protein

UniProt ID

P10276

Protein name

Retinoic acid receptor alpha (RAR-alpha) (Nuclear receptor subfamily 1 group B member 1)

Protein function

Receptor for retinoic acid (PubMed:16417524, PubMed:19850744, PubMed:20215566, PubMed:21152046, PubMed:37478846). Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis ret

PDB

1DKF , 1DSZ , 3A9E , 3KMR , 3KMZ , 4DQM , 5K13 , 6XWG , 7AOS , 7APO , 7QAA , 7WQQ , 9GFE , 9GFI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	86 → 155	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	224 → 401	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in monocytes. {ECO:0000269|PubMed:26463675}.

Sequence

MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

Sequence length

462

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Multiple Congenital Anomalies	multiple congenital anomalies/dysmorphic syndrome	N/A	N/A	GenCC
Promyelocytic Leukemia	acute promyelocytic leukemia	N/A	N/A	GenCC

Show/Hide Text Mining Associations (102)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acne Vulgaris	Associate	16575387
Acute erythroleukemia	Associate	11552979
Adenocarcinoma	Associate	19670330, 8398710, 9708807
Alzheimer Disease	Associate	29848990
Anorchia	Associate	26431381
Arnold Chiari Malformation	Associate	23437350
Arthritis Rheumatoid	Associate	24089231
Atherosclerosis	Associate	19628791
Autoimmune Diseases	Associate	37597518
Blood Coagulation Disorders	Associate	1317727, 20133705
Breast Neoplasms	Associate	10364250, 17998817, 18332872, 18650449, 20080953, 21288332, 21299862, 22084256, 23474897, 23868472, 25287138, 26313912, 27894085, 28350049, 28692043 View all (6 more)
Calcinosis	Associate	31852220
Carcinogenesis	Inhibit	10389997
Carcinogenesis	Associate	25300573, 7858248
Carcinoma Adenoid Cystic	Associate	37040084
Carcinoma Hepatocellular	Associate	24564241, 33090723
Carcinoma Ovarian Epithelial	Associate	16012182
Carcinoma Squamous Cell	Associate	11077050
Cell Transformation Viral	Associate	19451220
Cholestasis	Associate	25798860
Cleft Lip	Associate	1361101
Cleft Palate	Associate	7485164
Colorectal Neoplasms	Associate	28483913, 33472949
Compassion Fatigue	Associate	17225872
Craniosynostoses	Associate	37086723
Diabetes Mellitus Type 1	Associate	30910956
Drug Hypersensitivity	Associate	30986261
Drug Related Side Effects and Adverse Reactions	Associate	25963741
Emanuel syndrome	Associate	18000064, 7849296
Endometrial Neoplasms	Associate	21310893, 28375930
Esophagitis	Associate	11315258
Fever	Inhibit	36216898
Gastrointestinal Neoplasms	Associate	32883271
Glomerulonephritis IGA	Associate	20957306
Glomerulosclerosis Focal Segmental	Associate	22351778
Graft vs Host Disease	Associate	32905596
Graves Ophthalmopathy	Associate	29791662
Hematologic Diseases	Associate	8639801, 9680345
Hereditary Breast and Ovarian Cancer Syndrome	Associate	12200354, 8669476
HIV Infections	Inhibit	23106848
Hyperlipidemias	Associate	37947652
Hyperlipoproteinemia Type II	Stimulate	8634442
Hypothyroidism	Associate	37947652
Idiopathic Pulmonary Fibrosis	Associate	20451601
Inflammation	Associate	30986261
Inflammatory Bowel Diseases	Associate	35275975
Intestinal Diseases	Inhibit	10389997
Laryngeal Neoplasms	Associate	28122350
Leukemia	Associate	10601023, 12213824, 1372989, 15729358, 16449642, 18650449, 19451220, 2175343, 23898169, 24516348, 2546626, 35963522, 7858248, 8514604, 8634447, 9256429, 9269772, 9593784, 9716606 View all (4 more)
Leukemia Biphenotypic Acute	Associate	24769646, 8639801
Leukemia Lymphocytic Chronic B Cell	Associate	10192433
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	35963522
Leukemia Myeloid	Associate	10068679, 10192433, 12393712, 1670759, 19451220, 1970118, 20826193, 30225259, 8530518
Leukemia Myeloid Acute	Associate	10233384, 10940650, 10942402, 11552979, 12130525, 15729358, 16630339, 17177193, 17993618, 18000064, 20739655, 23091311, 23547873, 23941359, 24769646 View all (21 more)
Leukemia Promyelocytic Acute	Associate	10029573, 10225671, 10233384, 10553155, 10601023, 10627441, 10669754, 10753851, 10940650, 10942370, 10942371, 10942402, 11023521, 11050004, 11090081 View all (190 more)
Liver Diseases	Associate	21272161
Liver Failure	Inhibit	17272513
Lung Neoplasms	Associate	26557664
Lymphoma	Associate	10192433
Lymphoma T Cell	Associate	28412739
Lymphoma T Cell Cutaneous	Associate	25826424, 28370539, 28694326
Lymphoma T Cell Peripheral	Associate	28412739
Macular Edema	Associate	31968263
Medulloblastoma	Associate	19966297
Melanoma	Associate	20548792, 9228081
Meningomyelocele	Associate	21254357
Multiple Myeloma	Associate	17229644
Myelodysplastic Syndromes	Associate	10192433, 11122147, 36130886, 36477975, 37571998, 38418133
Myopia	Associate	19626135
Neoplasm Metastasis	Stimulate	29378601
Neoplasms	Associate	10192433, 11092983, 1372989, 19966297, 20507312, 22944049, 25287138, 27894085, 28483913, 30674964, 30915882, 32322022, 32735792, 33727697, 35963522, 8669476, 8794365, 9708807 View all (3 more)
Neoplasms	Inhibit	10389997, 22901127, 28375930, 33935126
Neoplasms Fibroepithelial	Associate	32322022
Neuroblastoma	Associate	25963741, 32149119
Oncogene Addiction	Associate	16473273
Osteoporosis	Associate	25815782
Osteosarcoma	Associate	24608861, 32916897
Ovarian Neoplasms	Associate	16012182
Pancreatic Neoplasms	Associate	10938282, 29169171
Phyllodes Tumor	Associate	31647027, 33727697
Plaque Atherosclerotic	Associate	19628791
Pneumonia Aspiration	Associate	30225259
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10192433, 11552979, 32391634, 9609531
Prostatic Hyperplasia	Stimulate	12399530
Prostatic Intraepithelial Neoplasia	Associate	12399530
Prostatic Neoplasms	Associate	12399530, 30828077, 32881426
Prostatitis	Associate	11487280, 15266311
Recurrence	Associate	9680345
Retinal Dysplasia	Inhibit	10389997
Retinoblastoma	Associate	33935126, 9260893
Rhabdomyosarcoma	Associate	25915942
Schizophrenia	Associate	24564241, 28696354
Sepsis	Associate	33949285
Skin Diseases	Associate	33203692
Stevens Johnson Syndrome	Associate	37947652
Stomach Neoplasms	Inhibit	10389997
Stomach Neoplasms	Associate	11819850, 22901127
Thyroid Cancer Papillary	Associate	25908172
Thyroid Hormone Resistance Syndrome	Associate	7913468
Triple Negative Breast Neoplasms	Associate	28350049, 37093683
Uterine Cervical Neoplasms	Associate	21736279
Wilms Tumor	Associate	29378601

RARA (retinoic acid receptor alpha)