Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10411
Gene name Gene Name - the full gene name approved by the HGNC.	Rap guanine nucleotide exchange factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAPGEF3
Synonyms (NCBI Gene) Gene synonyms aliases	CAMP-GEFI, EPAC, EPAC1, HSU79275, bcm910
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.11

Show/Hide all(121)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019181	hsa-miR-335-5p	Microarray	18185580
MIRT023183	hsa-miR-124-3p	Microarray	18668037
MIRT527554	hsa-miR-6782-3p	PAR-CLIP	22012620
MIRT527553	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT527552	hsa-miR-4286	PAR-CLIP	22012620
MIRT527551	hsa-miR-4290	PAR-CLIP	22012620
MIRT735923	hsa-miR-7-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33553184
MIRT527554	hsa-miR-6782-3p	PAR-CLIP	22012620
MIRT527553	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT527552	hsa-miR-4286	PAR-CLIP	22012620
MIRT527551	hsa-miR-4290	PAR-CLIP	22012620
MIRT1290767	hsa-miR-1343	CLIP-seq
MIRT1290768	hsa-miR-2276	CLIP-seq
MIRT1290769	hsa-miR-3074-5p	CLIP-seq
MIRT1290770	hsa-miR-3173-3p	CLIP-seq
MIRT1290771	hsa-miR-3682-3p	CLIP-seq
MIRT1290772	hsa-miR-4270	CLIP-seq
MIRT1290773	hsa-miR-4419a	CLIP-seq
MIRT1290774	hsa-miR-4434	CLIP-seq
MIRT1290775	hsa-miR-4441	CLIP-seq
MIRT1290776	hsa-miR-4502	CLIP-seq
MIRT1290777	hsa-miR-4510	CLIP-seq
MIRT1290778	hsa-miR-4516	CLIP-seq
MIRT1290779	hsa-miR-4685-5p	CLIP-seq
MIRT1290780	hsa-miR-4763-5p	CLIP-seq
MIRT1290781	hsa-miR-4779	CLIP-seq
MIRT1290782	hsa-miR-515-3p	CLIP-seq
MIRT1290783	hsa-miR-519e	CLIP-seq
MIRT1290784	hsa-miR-550a	CLIP-seq
MIRT1290785	hsa-miR-635	CLIP-seq
MIRT1290786	hsa-miR-765	CLIP-seq
MIRT1290787	hsa-miR-766	CLIP-seq
MIRT1290788	hsa-miR-1205	CLIP-seq
MIRT1290789	hsa-miR-1207-5p	CLIP-seq
MIRT1290790	hsa-miR-1233	CLIP-seq
MIRT1290791	hsa-miR-1266	CLIP-seq
MIRT1290792	hsa-miR-1269	CLIP-seq
MIRT1290793	hsa-miR-1269b	CLIP-seq
MIRT1290794	hsa-miR-1288	CLIP-seq
MIRT1290795	hsa-miR-1293	CLIP-seq
MIRT1290796	hsa-miR-1909	CLIP-seq
MIRT1290797	hsa-miR-2117	CLIP-seq
MIRT1290798	hsa-miR-3127-5p	CLIP-seq
MIRT1290799	hsa-miR-3155	CLIP-seq
MIRT1290800	hsa-miR-3155b	CLIP-seq
MIRT1290801	hsa-miR-3179	CLIP-seq
MIRT1290802	hsa-miR-3187-3p	CLIP-seq
MIRT1290803	hsa-miR-323-5p	CLIP-seq
MIRT1290804	hsa-miR-3607-3p	CLIP-seq
MIRT1290805	hsa-miR-3612	CLIP-seq
MIRT1290806	hsa-miR-370	CLIP-seq
MIRT1290807	hsa-miR-378	CLIP-seq
MIRT1290808	hsa-miR-378b	CLIP-seq
MIRT1290809	hsa-miR-378c	CLIP-seq
MIRT1290810	hsa-miR-378d	CLIP-seq
MIRT1290811	hsa-miR-378e	CLIP-seq
MIRT1290812	hsa-miR-378f	CLIP-seq
MIRT1290813	hsa-miR-378h	CLIP-seq
MIRT1290814	hsa-miR-378i	CLIP-seq
MIRT1290815	hsa-miR-3918	CLIP-seq
MIRT1290816	hsa-miR-422a	CLIP-seq
MIRT1290817	hsa-miR-4254	CLIP-seq
MIRT1290818	hsa-miR-4283	CLIP-seq
MIRT1290819	hsa-miR-4308	CLIP-seq
MIRT1290820	hsa-miR-4435	CLIP-seq
MIRT1290821	hsa-miR-4443	CLIP-seq
MIRT1290822	hsa-miR-4483	CLIP-seq
MIRT1290823	hsa-miR-4515	CLIP-seq
MIRT1290824	hsa-miR-4518	CLIP-seq
MIRT1290825	hsa-miR-4527	CLIP-seq
MIRT1290826	hsa-miR-4638-3p	CLIP-seq
MIRT1290827	hsa-miR-4645-5p	CLIP-seq
MIRT1290828	hsa-miR-4673	CLIP-seq
MIRT1290829	hsa-miR-4688	CLIP-seq
MIRT1290830	hsa-miR-4701-5p	CLIP-seq
MIRT1290831	hsa-miR-4707-3p	CLIP-seq
MIRT1290832	hsa-miR-4740-5p	CLIP-seq
MIRT1290833	hsa-miR-4755-3p	CLIP-seq
MIRT1290834	hsa-miR-4763-3p	CLIP-seq
MIRT1290835	hsa-miR-4768-5p	CLIP-seq
MIRT1290836	hsa-miR-484	CLIP-seq
MIRT1290837	hsa-miR-486-3p	CLIP-seq
MIRT1290838	hsa-miR-510	CLIP-seq
MIRT1290839	hsa-miR-512-3p	CLIP-seq
MIRT1290840	hsa-miR-548s	CLIP-seq
MIRT1290841	hsa-miR-588	CLIP-seq
MIRT1290842	hsa-miR-604	CLIP-seq
MIRT1290843	hsa-miR-647	CLIP-seq
MIRT1290844	hsa-miR-650	CLIP-seq
MIRT1290787	hsa-miR-766	CLIP-seq
MIRT2086495	hsa-miR-513a-5p	CLIP-seq
MIRT2311557	hsa-miR-1228	CLIP-seq
MIRT2311558	hsa-miR-1248	CLIP-seq
MIRT2311559	hsa-miR-1301	CLIP-seq
MIRT2311560	hsa-miR-214	CLIP-seq
MIRT2311561	hsa-miR-3064-5p	CLIP-seq
MIRT2311562	hsa-miR-3119	CLIP-seq
MIRT2311563	hsa-miR-3140-3p	CLIP-seq
MIRT2311564	hsa-miR-3619-5p	CLIP-seq
MIRT2311565	hsa-miR-3652	CLIP-seq
MIRT2311566	hsa-miR-4274	CLIP-seq
MIRT2311567	hsa-miR-4291	CLIP-seq
MIRT2311568	hsa-miR-4430	CLIP-seq
MIRT2311569	hsa-miR-4505	CLIP-seq
MIRT2311570	hsa-miR-4650-5p	CLIP-seq
MIRT2311571	hsa-miR-4659a-3p	CLIP-seq
MIRT2311572	hsa-miR-4659b-3p	CLIP-seq
MIRT2311573	hsa-miR-4660	CLIP-seq
MIRT2311574	hsa-miR-4778-3p	CLIP-seq
MIRT2311575	hsa-miR-5047	CLIP-seq
MIRT2311576	hsa-miR-761	CLIP-seq
MIRT2311577	hsa-miR-922	CLIP-seq
MIRT2311578	hsa-miR-942	CLIP-seq
MIRT2457750	hsa-miR-124	CLIP-seq
MIRT2457751	hsa-miR-3065-5p	CLIP-seq
MIRT2457752	hsa-miR-3714	CLIP-seq
MIRT2457753	hsa-miR-3910	CLIP-seq
MIRT1290826	hsa-miR-4638-3p	CLIP-seq
MIRT2457754	hsa-miR-4786-3p	CLIP-seq
MIRT2457755	hsa-miR-506	CLIP-seq
MIRT2457756	hsa-miR-885-3p	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	21840392
GO:0005515	Function	Protein binding	IPI	21393242
GO:0005886	Component	Plasma membrane	IDA	21047789
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	21047789
GO:0007165	Process	Signal transduction	TAS	9853756
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	TAS	10777494
GO:0019904	Function	Protein domain specific binding	IPI	21047789
GO:0019933	Process	CAMP-mediated signaling	NAS	16177794
GO:0030027	Component	Lamellipodium	IDA	21047789
GO:0030175	Component	Filopodium	IDA	21047789
GO:0030552	Function	CAMP binding	IEA
GO:0030864	Component	Cortical actin cytoskeleton	IDA	21047789
GO:0032486	Process	Rap protein signal transduction	IMP	21840392
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	23867755
GO:0034242	Process	Negative regulation of syncytium formation by plasma membrane fusion	IMP	23867755
GO:0043547	Process	Positive regulation of GTPase activity	IMP	21840392
GO:0045766	Process	Positive regulation of angiogenesis	IMP	21393242
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	23867755
GO:0050796	Process	Regulation of insulin secretion	TAS
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	21840392
GO:0060143	Process	Positive regulation of syncytium formation by plasma membrane fusion	IMP	23867755
GO:0061028	Process	Establishment of endothelial barrier	IMP	21840392
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071320	Process	Cellular response to cAMP	IDA	21840392
GO:1901985	Process	Positive regulation of protein acetylation	IMP	23867755
GO:2000249	Process	Regulation of actin cytoskeleton reorganization	IMP	21840392
GO:2000615	Process	Regulation of histone H3-K9 acetylation	IMP	23867755

MIM	HGNC	e!Ensembl
606057	16629	ENSG00000079337

Protein

UniProt ID

O95398

Protein name

Rap guanine nucleotide exchange factor 3 (Exchange factor directly activated by cAMP 1) (Exchange protein directly activated by cAMP 1) (EPAC 1) (Rap1 guanine-nucleotide-exchange factor directly activated by cAMP) (cAMP-regulated guanine nucleotide exchan

Protein function

Guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which it activates the PI3K gamma co

PDB

6H7E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00610	DEP	114 → 184	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
PF00027	cNMP_binding	265 → 348	Cyclic nucleotide-binding domain	Domain
PF00618	RasGEF_N	387 → 493	RasGEF N-terminal motif	Domain
PF00617	RasGEF	665 → 843	RasGEF domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in adult kidney, heart, thyroid and brain, and fetal kidney. {ECO:0000269|PubMed:9856955}.

Sequence

MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLL
EHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
FYRFPGPEPEPVRTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD
FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSML
HTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWL
PNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDL
VSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWA
YVQQLKVIDNQRELSRLSRELEP

Sequence length

923

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Hypothyroidism	Hypothyroidism			GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining
Acidosis	Associate	22110680
Adenocarcinoma of Lung	Associate	32998690
Airway Remodeling	Associate	21426315
Anxiety	Associate	19475578
Asthma	Associate	21426315, 31932625
Breast Neoplasms	Stimulate	28755423
Breast Neoplasms	Associate	39270542
C9 Deficiency	Inhibit	33362237
Carcinogenesis	Associate	24316969
Carcinoma Hepatocellular	Associate	31514484
Cardiovascular Diseases	Associate	31316160, 31726720
Congenital heart block	Associate	28626076
Depressive Disorder	Associate	19475578
Diabetes Mellitus	Associate	31726720
Esophageal Neoplasms	Associate	28771997
Frontotemporal Dementia	Associate	33362237
Hearing Loss	Associate	36656851
Inflammation	Associate	22363678, 23646189
Inflammation	Inhibit	30395484
Leukemia Biphenotypic Acute	Associate	34257610
Leukemia Lymphocytic Chronic B Cell	Associate	14615375
Lung Neoplasms	Associate	23523631, 27534532, 28232663, 29528086
Lymphatic Metastasis	Associate	29528086
Melanoma	Associate	24725364
Metabolic Diseases	Associate	38195707
Neoplasm Metastasis	Inhibit	29528086
Neoplasms	Associate	29528086, 29982410, 30809467, 34257610, 39270542
Obesity	Inhibit	38195707
Pemphigus	Associate	31681304
Prostatic Neoplasms	Associate	19725049, 23646189
Pulmonary Disease Chronic Obstructive	Inhibit	22363678
Pulmonary Disease Chronic Obstructive	Associate	30395484, 30988604
Rectal Neoplasms	Associate	30809467
Stomach Neoplasms	Associate	28260059
Triple Negative Breast Neoplasms	Associate	29982410
Vascular Remodeling	Associate	31316160

RAPGEF3 (Rap guanine nucleotide exchange factor 3)