Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5881
Gene name Gene Name - the full gene name approved by the HGNC.	Rac family small GTPase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAC3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorgani

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1064797229	G>A	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs1379395211	C>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs1568018697	C>T	Association, pathogenic	Missense variant, coding sequence variant
rs1568018920	A>T	Association, pathogenic	Missense variant, coding sequence variant

Show/Hide all(47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038692	hsa-miR-30c-2-3p	CLASH	23622248
MIRT718787	hsa-miR-4687-5p	HITS-CLIP	19536157
MIRT718786	hsa-miR-4446-3p	HITS-CLIP	19536157
MIRT718785	hsa-miR-3155a	HITS-CLIP	19536157
MIRT718784	hsa-miR-3155b	HITS-CLIP	19536157
MIRT718783	hsa-miR-484	HITS-CLIP	19536157
MIRT718782	hsa-miR-4258	HITS-CLIP	19536157
MIRT718781	hsa-miR-3194-5p	HITS-CLIP	19536157
MIRT718780	hsa-miR-7106-3p	HITS-CLIP	19536157
MIRT718779	hsa-miR-6762-3p	HITS-CLIP	19536157
MIRT718778	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT346165	hsa-miR-3662	PAR-CLIP	20371350
MIRT346158	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT560904	hsa-miR-6815-5p	PAR-CLIP	20371350
MIRT560903	hsa-miR-6865-5p	PAR-CLIP	20371350
MIRT346163	hsa-miR-3163	PAR-CLIP	20371350
MIRT346166	hsa-miR-4434	PAR-CLIP	20371350
MIRT346167	hsa-miR-4516	PAR-CLIP	20371350
MIRT346169	hsa-miR-5703	PAR-CLIP	20371350
MIRT346171	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT560902	hsa-miR-6802-5p	PAR-CLIP	20371350
MIRT560901	hsa-miR-5701	PAR-CLIP	20371350
MIRT346168	hsa-miR-4531	PAR-CLIP	20371350
MIRT346160	hsa-miR-568	PAR-CLIP	20371350
MIRT718787	hsa-miR-4687-5p	HITS-CLIP	19536157
MIRT718786	hsa-miR-4446-3p	HITS-CLIP	19536157
MIRT718785	hsa-miR-3155a	HITS-CLIP	19536157
MIRT718784	hsa-miR-3155b	HITS-CLIP	19536157
MIRT718783	hsa-miR-484	HITS-CLIP	19536157
MIRT718782	hsa-miR-4258	HITS-CLIP	19536157
MIRT718781	hsa-miR-3194-5p	HITS-CLIP	19536157
MIRT718780	hsa-miR-7106-3p	HITS-CLIP	19536157
MIRT718779	hsa-miR-6762-3p	HITS-CLIP	19536157
MIRT718778	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT346165	hsa-miR-3662	PAR-CLIP	20371350
MIRT346158	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT560904	hsa-miR-6815-5p	PAR-CLIP	20371350
MIRT560903	hsa-miR-6865-5p	PAR-CLIP	20371350
MIRT346163	hsa-miR-3163	PAR-CLIP	20371350
MIRT346166	hsa-miR-4434	PAR-CLIP	20371350
MIRT346167	hsa-miR-4516	PAR-CLIP	20371350
MIRT346169	hsa-miR-5703	PAR-CLIP	20371350
MIRT346171	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT560902	hsa-miR-6802-5p	PAR-CLIP	20371350
MIRT560901	hsa-miR-5701	PAR-CLIP	20371350
MIRT346168	hsa-miR-4531	PAR-CLIP	20371350
MIRT346160	hsa-miR-568	PAR-CLIP	20371350

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0003924	Function	GTPase activity	IDA	11956649
GO:0005515	Function	Protein binding	IPI	11956649, 21217774, 32296183
GO:0005525	Function	GTP binding	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IBA	21873635
GO:0007015	Process	Actin filament organization	IBA	21873635
GO:0007163	Process	Establishment or maintenance of cell polarity	IBA	21873635
GO:0007264	Process	Small GTPase mediated signal transduction	IEA
GO:0008360	Process	Regulation of cell shape	IBA	21873635
GO:0012505	Component	Endomembrane system	IDA	11956649
GO:0014041	Process	Regulation of neuron maturation	IEA
GO:0016055	Process	Wnt signaling pathway	IMP	29276006
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0021894	Process	Cerebral cortex GABAergic interneuron development	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030031	Process	Cell projection assembly	IDA	11956649
GO:0030036	Process	Actin cytoskeleton organization	IDA	11956649
GO:0030426	Component	Growth cone	IDA	16525025
GO:0030865	Process	Cortical cytoskeleton organization	IBA	21873635
GO:0031175	Process	Neuron projection development	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA	21873635
GO:0031941	Component	Filamentous actin	IDA	16525025
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA	21873635
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IDA	11756406
GO:0035556	Process	Intracellular signal transduction	TAS	9252344
GO:0042995	Component	Cell projection	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043005	Component	Neuron projection	IDA	16525025
GO:0043025	Component	Neuronal cell body	IDA	16525025
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA	21873635
GO:0045202	Component	Synapse	IEA
GO:0048306	Function	Calcium-dependent protein binding	IPI	11756406
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11756406
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051932	Process	Synaptic transmission, GABAergic	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071944	Component	Cell periphery	IDA	11756406
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IDA	11756406

MIM	HGNC	e!Ensembl
602050	9803	ENSG00000169750

Protein

UniProt ID

P60763

Protein name

Ras-related C3 botulinum toxin substrate 3 (EC 3.6.5.2) (p21-Rac3)

Protein function

Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of ac

PDB

2C2H , 2G0N , 2IC5 , 2OV2 , 2QME , 6TM1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	5 → 178	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in brain, also detected in heart, placenta and pancreas.

Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF

Sequence length

192

Interactions

View interactions

RAC3 (Rac family small GTPase 3)