Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5880
Gene name Gene Name - the full gene name approved by the HGNC.	Rac family small GTPase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAC2
Synonyms (NCBI Gene) Gene synonyms aliases	EN-7, Gx, HSPC022, IMD73A, IMD73B, IMD73C, p21-Rac2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IMD73A, IMD73B, IMD73C
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarizati

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs74315507	C>T	Pathogenic	Coding sequence variant, missense variant
rs1555908409	C>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant

Show/Hide all(152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016574	hsa-miR-193b-3p	Microarray	20304954
MIRT755715	hsa-miR-1246	Western blotting, RNA-seq	38287447
MIRT1287073	hsa-miR-103a	CLIP-seq
MIRT1287074	hsa-miR-107	CLIP-seq
MIRT1287075	hsa-miR-122	CLIP-seq
MIRT1287076	hsa-miR-1914	CLIP-seq
MIRT1287077	hsa-miR-3180-5p	CLIP-seq
MIRT1287078	hsa-miR-3199	CLIP-seq
MIRT1287079	hsa-miR-342-5p	CLIP-seq
MIRT1287080	hsa-miR-3664-3p	CLIP-seq
MIRT1287081	hsa-miR-3937	CLIP-seq
MIRT1287082	hsa-miR-3944-5p	CLIP-seq
MIRT1287083	hsa-miR-4515	CLIP-seq
MIRT1287084	hsa-miR-4648	CLIP-seq
MIRT1287085	hsa-miR-4651	CLIP-seq
MIRT1287086	hsa-miR-4661-3p	CLIP-seq
MIRT1287087	hsa-miR-4664-5p	CLIP-seq
MIRT1287088	hsa-miR-4677-3p	CLIP-seq
MIRT1287089	hsa-miR-520a-5p	CLIP-seq
MIRT1287090	hsa-miR-525-5p	CLIP-seq
MIRT1287091	hsa-miR-608	CLIP-seq
MIRT1287092	hsa-miR-887	CLIP-seq
MIRT1287093	hsa-miR-922	CLIP-seq
MIRT1556923	hsa-miR-1286	CLIP-seq
MIRT1556924	hsa-miR-219-1-3p	CLIP-seq
MIRT1556925	hsa-miR-31	CLIP-seq
MIRT1556926	hsa-miR-3125	CLIP-seq
MIRT1556927	hsa-miR-3128	CLIP-seq
MIRT1556928	hsa-miR-3132	CLIP-seq
MIRT1556929	hsa-miR-326	CLIP-seq
MIRT1556930	hsa-miR-330-5p	CLIP-seq
MIRT1556931	hsa-miR-3916	CLIP-seq
MIRT1556932	hsa-miR-3928	CLIP-seq
MIRT1556933	hsa-miR-3940-5p	CLIP-seq
MIRT1556934	hsa-miR-4259	CLIP-seq
MIRT1556935	hsa-miR-4451	CLIP-seq
MIRT1556936	hsa-miR-4503	CLIP-seq
MIRT1556937	hsa-miR-4507	CLIP-seq
MIRT1556938	hsa-miR-4680-5p	CLIP-seq
MIRT1556939	hsa-miR-4720-3p	CLIP-seq
MIRT1556940	hsa-miR-4720-5p	CLIP-seq
MIRT1556941	hsa-miR-4731-5p	CLIP-seq
MIRT1556942	hsa-miR-4799-3p	CLIP-seq
MIRT1556943	hsa-miR-4804-3p	CLIP-seq
MIRT1556944	hsa-miR-544	CLIP-seq
MIRT1556945	hsa-miR-571	CLIP-seq
MIRT1556946	hsa-miR-629	CLIP-seq
MIRT1556947	hsa-miR-657	CLIP-seq
MIRT1556948	hsa-miR-877	CLIP-seq
MIRT2310539	hsa-miR-3126-3p	CLIP-seq
MIRT2310540	hsa-miR-3176	CLIP-seq
MIRT2310541	hsa-miR-3688-5p	CLIP-seq
MIRT2310542	hsa-miR-382	CLIP-seq
MIRT2310543	hsa-miR-3922-3p	CLIP-seq
MIRT2310544	hsa-miR-4474-3p	CLIP-seq
MIRT2310545	hsa-miR-885-3p	CLIP-seq
MIRT1287073	hsa-miR-103a	CLIP-seq
MIRT1287074	hsa-miR-107	CLIP-seq
MIRT2393373	hsa-miR-3065-3p	CLIP-seq
MIRT2393374	hsa-miR-4506	CLIP-seq
MIRT2393375	hsa-miR-450b-3p	CLIP-seq
MIRT1287085	hsa-miR-4651	CLIP-seq
MIRT2393376	hsa-miR-4787-5p	CLIP-seq
MIRT2393377	hsa-miR-602	CLIP-seq
MIRT1287091	hsa-miR-608	CLIP-seq
MIRT2393378	hsa-miR-769-3p	CLIP-seq
MIRT2393379	hsa-miR-873	CLIP-seq
MIRT1287073	hsa-miR-103a	CLIP-seq
MIRT1287074	hsa-miR-107	CLIP-seq
MIRT2606939	hsa-miR-1207-5p	CLIP-seq
MIRT2606940	hsa-miR-1264	CLIP-seq
MIRT2606941	hsa-miR-1301	CLIP-seq
MIRT2606942	hsa-miR-1909	CLIP-seq
MIRT1287076	hsa-miR-1914	CLIP-seq
MIRT2606943	hsa-miR-302a	CLIP-seq
MIRT2606944	hsa-miR-302b	CLIP-seq
MIRT2606945	hsa-miR-302c	CLIP-seq
MIRT2606946	hsa-miR-302d	CLIP-seq
MIRT2606947	hsa-miR-302e	CLIP-seq
MIRT1556925	hsa-miR-31	CLIP-seq
MIRT2606948	hsa-miR-342-3p	CLIP-seq
MIRT2606949	hsa-miR-3653	CLIP-seq
MIRT2606950	hsa-miR-3658	CLIP-seq
MIRT1287080	hsa-miR-3664-3p	CLIP-seq
MIRT2606951	hsa-miR-372	CLIP-seq
MIRT2606952	hsa-miR-373	CLIP-seq
MIRT1287082	hsa-miR-3944-5p	CLIP-seq
MIRT2606953	hsa-miR-4432	CLIP-seq
MIRT2606954	hsa-miR-4492	CLIP-seq
MIRT2606955	hsa-miR-4498	CLIP-seq
MIRT2606956	hsa-miR-4660	CLIP-seq
MIRT1287086	hsa-miR-4661-3p	CLIP-seq
MIRT1287088	hsa-miR-4677-3p	CLIP-seq
MIRT2606957	hsa-miR-4709-3p	CLIP-seq
MIRT2606958	hsa-miR-4736	CLIP-seq
MIRT2606959	hsa-miR-4763-3p	CLIP-seq
MIRT2606960	hsa-miR-5047	CLIP-seq
MIRT2606961	hsa-miR-513a-5p	CLIP-seq
MIRT2606962	hsa-miR-519a	CLIP-seq
MIRT2606963	hsa-miR-519b-3p	CLIP-seq
MIRT2606964	hsa-miR-519c-3p	CLIP-seq
MIRT2606965	hsa-miR-520a-3p	CLIP-seq
MIRT2606966	hsa-miR-520b	CLIP-seq
MIRT2606967	hsa-miR-520c-3p	CLIP-seq
MIRT2606968	hsa-miR-520d-3p	CLIP-seq
MIRT2606969	hsa-miR-520e	CLIP-seq
MIRT2606970	hsa-miR-548n	CLIP-seq
MIRT2606971	hsa-miR-548t	CLIP-seq
MIRT2606972	hsa-miR-561	CLIP-seq
MIRT2606973	hsa-miR-563	CLIP-seq
MIRT2606974	hsa-miR-762	CLIP-seq
MIRT1287093	hsa-miR-922	CLIP-seq
MIRT1287073	hsa-miR-103a	CLIP-seq
MIRT1287074	hsa-miR-107	CLIP-seq
MIRT2606939	hsa-miR-1207-5p	CLIP-seq
MIRT2606940	hsa-miR-1264	CLIP-seq
MIRT2606941	hsa-miR-1301	CLIP-seq
MIRT2606942	hsa-miR-1909	CLIP-seq
MIRT2689276	hsa-miR-1912	CLIP-seq
MIRT1287076	hsa-miR-1914	CLIP-seq
MIRT2606943	hsa-miR-302a	CLIP-seq
MIRT2606944	hsa-miR-302b	CLIP-seq
MIRT2606945	hsa-miR-302c	CLIP-seq
MIRT2606946	hsa-miR-302d	CLIP-seq
MIRT2606947	hsa-miR-302e	CLIP-seq
MIRT2606948	hsa-miR-342-3p	CLIP-seq
MIRT2606949	hsa-miR-3653	CLIP-seq
MIRT2606950	hsa-miR-3658	CLIP-seq
MIRT1287080	hsa-miR-3664-3p	CLIP-seq
MIRT2606951	hsa-miR-372	CLIP-seq
MIRT2606952	hsa-miR-373	CLIP-seq
MIRT1287082	hsa-miR-3944-5p	CLIP-seq
MIRT2606954	hsa-miR-4492	CLIP-seq
MIRT2606955	hsa-miR-4498	CLIP-seq
MIRT2606956	hsa-miR-4660	CLIP-seq
MIRT1287086	hsa-miR-4661-3p	CLIP-seq
MIRT1287088	hsa-miR-4677-3p	CLIP-seq
MIRT2606958	hsa-miR-4736	CLIP-seq
MIRT2606959	hsa-miR-4763-3p	CLIP-seq
MIRT2606960	hsa-miR-5047	CLIP-seq
MIRT2606961	hsa-miR-513a-5p	CLIP-seq
MIRT2606962	hsa-miR-519a	CLIP-seq
MIRT2606963	hsa-miR-519b-3p	CLIP-seq
MIRT2606964	hsa-miR-519c-3p	CLIP-seq
MIRT2606965	hsa-miR-520a-3p	CLIP-seq
MIRT2606966	hsa-miR-520b	CLIP-seq
MIRT2606967	hsa-miR-520c-3p	CLIP-seq
MIRT2606968	hsa-miR-520d-3p	CLIP-seq
MIRT2606969	hsa-miR-520e	CLIP-seq
MIRT2606973	hsa-miR-563	CLIP-seq
MIRT2606974	hsa-miR-762	CLIP-seq
MIRT1287093	hsa-miR-922	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	22106281, 22949657, 32296183
GO:0005525	Function	GTP binding	IBA	21873635
GO:0005525	Function	GTP binding	IMP	19625648
GO:0005635	Component	Nuclear envelope	IEA
GO:0005829	Component	Cytosol	IDA	19625648
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA	21873635
GO:0005884	Component	Actin filament	IDA	19625648
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005938	Component	Cell cortex	IBA	21873635
GO:0007015	Process	Actin filament organization	IBA	21873635
GO:0007015	Process	Actin filament organization	IMP	21167572
GO:0007163	Process	Establishment or maintenance of cell polarity	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	2674130
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008045	Process	Motor neuron axon guidance	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008360	Process	Regulation of cell shape	IBA	21873635
GO:0010310	Process	Regulation of hydrogen peroxide metabolic process	TAS	16636067
GO:0010592	Process	Positive regulation of lamellipodium assembly	IMP	19625648
GO:0010810	Process	Regulation of cell-substrate adhesion	IMP	21167572
GO:0016601	Process	Rac protein signal transduction	IBA	21873635
GO:0019887	Function	Protein kinase regulator activity	IEA
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0030027	Component	Lamellipodium	IDA	19625648
GO:0030031	Process	Cell projection assembly	IBA	21873635
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0030865	Process	Cortical cytoskeleton organization	IBA	21873635
GO:0031410	Component	Cytoplasmic vesicle	IBA	21873635
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA	21873635
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042995	Component	Cell projection	IBA	21873635
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA	21873635
GO:0043304	Process	Regulation of mast cell degranulation	IEA
GO:0043652	Process	Engulfment of apoptotic cell	IBA	21873635
GO:0045453	Process	Bone resorption	IEA
GO:0045454	Process	Cell redox homeostasis	TAS
GO:0045859	Process	Regulation of protein kinase activity	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0060263	Process	Regulation of respiratory burst	IDA	16636067
GO:0060753	Process	Regulation of mast cell chemotaxis	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0071593	Process	Lymphocyte aggregation	IMP	21167572
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IMP	19625648
GO:1902622	Process	Regulation of neutrophil migration	IBA	21873635
GO:1902622	Process	Regulation of neutrophil migration	IMP	21167572
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24270810

MIM	HGNC	e!Ensembl
602049	9802	ENSG00000128340

Protein

UniProt ID

P15153

Protein name

Ras-related C3 botulinum toxin substrate 2 (EC 3.6.5.2) (GX) (Small G protein) (p21-Rac2)

Protein function

Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state (PubMed:30723080). In its active state, binds to a variety of effector proteins to regulate cellular responses, such as secretory proce

PDB

1DS6 , 2W2T , 2W2V , 2W2X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	5 → 178	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Hematopoietic specific.

Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRACSLL

Sequence length

192

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Immunodeficiency	immunodeficiency 73c with defective neutrophil chemotaxis and hypogammaglobulinemia, immunodeficiency 73b with defective neutrophil chemotaxis and lymphopenia	GenCC
Neutrophil Immunodeficiency Syndrome	neutrophil immunodeficiency syndrome	GenCC
Celiac disease	Celiac disease	GWAS

Show/Hide Text Mining Associations (58)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	30720096
Arthritis Rheumatoid	Associate	17897462, 27626941, 32013628, 39980031
Atherosclerosis	Associate	34122426, 35937806
Bacterial Infections	Associate	38194689
Bone Marrow Diseases	Associate	31919089
Breast Neoplasms	Associate	23591873, 32044879, 35233733
Carcinogenesis	Stimulate	39596003
Carcinoma Hepatocellular	Associate	23728943
Carcinoma Renal Cell	Associate	28029655, 36854280, 39596003
Carcinoma Renal Cell	Stimulate	31364727
Carotid Stenosis	Associate	35773742
Celiac Disease	Associate	31591516
Cobblestone Lissencephaly	Associate	26016997
Crohn Disease	Associate	21900546
Death	Associate	35689244
Diabetic Nephropathies	Associate	34735495
Glioblastoma	Associate	19505917
Heart Failure	Associate	23927520
Immune System Diseases	Associate	32636302, 35689244, 38194689
Immunologic Deficiency Syndromes	Associate	10758162, 25512081, 38194689
Inflammation	Associate	39980031
Inflammatory Bowel Diseases	Associate	39273699
Intracranial Hypertension	Stimulate	18613964
Leukemia	Associate	19448413, 26016997
Leukemia Lymphocytic Chronic B Cell	Associate	34778802
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26072332
Leukocyte adhesion deficiency type 1	Associate	38194689
Leukoencephalopathy Progressive Multifocal	Associate	35689244
Leukopenia	Associate	31919089
Lymphatic Metastasis	Stimulate	31364727
Lymphopenia	Associate	38194689
Meningioma	Associate	20406964
Mitochondrial Diseases	Associate	26016997
Multiple Sclerosis	Associate	37657941
Myocardial Infarction	Associate	35864510
Nasopharyngeal Carcinoma	Associate	38518731
Neoplasm Metastasis	Associate	28944885, 32044879, 39233667
Neoplasms	Stimulate	11568556
Neoplasms	Associate	23576480, 30720096, 35261178, 39596003
Neurologic Manifestations	Associate	35689244
Neutropenia	Associate	38194689
Neutropenia Severe Congenital Autosomal Recessive 3	Inhibit	10779444
Neutrophil Immunodeficiency Syndrome	Associate	10758162, 38194689
Osteitis Deformans	Associate	39233667
Osteoporosis	Associate	35937806
Osteosarcoma	Associate	37537613
Prostatic Neoplasms	Associate	31389670
Psoriasis	Associate	34122426
Renal Insufficiency Chronic	Associate	31721901
Respiratory Tract Infections	Associate	38194689
Seizures	Associate	38166692
Severe Combined Immunodeficiency	Associate	31919089, 38194689
Spinal Cord Injuries	Associate	26497545
Squamous Cell Carcinoma of Head and Neck	Associate	11568556
Triple Negative Breast Neoplasms	Associate	28594844
Vascular Diseases	Associate	20530044
Virus Diseases	Associate	38194689
X Linked Combined Immunodeficiency Diseases	Associate	31919089, 38194689

RAC2 (Rac family small GTPase 2)