PTPRJ (protein tyrosine phosphatase receptor type J)

Gene

• Entrez ID: 5795
• Gene name: Protein tyrosine phosphatase receptor type J
• Gene symbol: PTPRJ
• Synonyms (NCBI Gene): CD148, DEP1, HPTP eta, HPTPeta, R-PTP-ETA, R-PTP-J, SCC1, THC10
• Chromosome: 11
• Chromosome location: 11p11.2
• Summary: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes, including cell growth, differentiation, mitotic cycle, and oncogenic tra

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1566734	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121434507	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001514	hsa-miR-155-5p	pSILAC	18668040
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT017530	hsa-miR-335-5p	Microarray	18185580
MIRT001514	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT022460	hsa-miR-124-3p	Microarray	18668037
MIRT029278	hsa-miR-26b-5p	Microarray	19088304
MIRT031605	hsa-miR-16-5p	Proteomics	18668040
MIRT049863	hsa-miR-31-5p	CLASH	23622248
MIRT469933	hsa-miR-6768-5p	HITS-CLIP	21572407
MIRT469932	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT469930	hsa-miR-936	HITS-CLIP	21572407
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	21572407
MIRT469925	hsa-miR-4672	HITS-CLIP	21572407
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	21572407
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT469930	hsa-miR-936	HITS-CLIP	23313552
MIRT469929	hsa-miR-190a-5p	HITS-CLIP	23313552
MIRT469928	hsa-miR-190b	HITS-CLIP	23313552
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	23313552
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	23313552
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	23313552
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT654623	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT654622	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT654621	hsa-miR-1303	HITS-CLIP	23824327
MIRT654620	hsa-miR-3149	HITS-CLIP	23824327
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT555125	hsa-miR-4280	PAR-CLIP	21572407
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT555124	hsa-miR-27b-5p	PAR-CLIP	21572407
MIRT555123	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT555121	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	22012620
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT469931	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT469930	hsa-miR-936	PAR-CLIP	22012620
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	22012620
MIRT469928	hsa-miR-190b	PAR-CLIP	22012620
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT469926	hsa-miR-597-5p	PAR-CLIP	22012620
MIRT469925	hsa-miR-4672	PAR-CLIP	22012620
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	22012620
MIRT534914	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT469923	hsa-miR-592	PAR-CLIP	22012620
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	23592263
MIRT469931	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT469930	hsa-miR-936	PAR-CLIP	23592263
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT469928	hsa-miR-190b	PAR-CLIP	23592263
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	23592263
MIRT469926	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469925	hsa-miR-4672	PAR-CLIP	23592263
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	23592263
MIRT469923	hsa-miR-592	PAR-CLIP	23592263
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT130344	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT130380	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT130382	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT031605	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT130383	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT130344	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT130343	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT130353	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT130342	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT734083	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT734083	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT734083	hsa-miR-34a-5p	Immunohistochemistry (IHC)	33192072
MIRT469933	hsa-miR-6768-5p	HITS-CLIP	21572407
MIRT469932	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT469930	hsa-miR-936	HITS-CLIP	21572407
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	21572407
MIRT469925	hsa-miR-4672	HITS-CLIP	21572407
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	21572407
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT469930	hsa-miR-936	HITS-CLIP	23313552
MIRT469929	hsa-miR-190a-5p	HITS-CLIP	23313552
MIRT469928	hsa-miR-190b	HITS-CLIP	23313552
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	23313552
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	23313552
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	23313552
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT654623	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT654622	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT654621	hsa-miR-1303	HITS-CLIP	23824327
MIRT654620	hsa-miR-3149	HITS-CLIP	23824327
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT555125	hsa-miR-4280	PAR-CLIP	21572407
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT555124	hsa-miR-27b-5p	PAR-CLIP	21572407
MIRT555123	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT555121	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	22012620
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT469931	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT469930	hsa-miR-936	PAR-CLIP	22012620
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	22012620
MIRT469928	hsa-miR-190b	PAR-CLIP	22012620
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT469926	hsa-miR-597-5p	PAR-CLIP	22012620
MIRT469925	hsa-miR-4672	PAR-CLIP	22012620
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	22012620
MIRT534914	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT469923	hsa-miR-592	PAR-CLIP	22012620
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	23592263
MIRT469931	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT469930	hsa-miR-936	PAR-CLIP	23592263
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT469928	hsa-miR-190b	PAR-CLIP	23592263
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	23592263
MIRT469926	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469925	hsa-miR-4672	PAR-CLIP	23592263
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	23592263
MIRT469923	hsa-miR-592	PAR-CLIP	23592263
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT1276207	hsa-miR-1224-5p	CLIP-seq
MIRT1276208	hsa-miR-125a-5p	CLIP-seq
MIRT1276209	hsa-miR-125b	CLIP-seq
MIRT1276210	hsa-miR-1268	CLIP-seq
MIRT1276211	hsa-miR-1268b	CLIP-seq
MIRT1276212	hsa-miR-1279	CLIP-seq
MIRT1276213	hsa-miR-1291	CLIP-seq
MIRT1276214	hsa-miR-1294	CLIP-seq
MIRT1276215	hsa-miR-155	CLIP-seq
MIRT1276216	hsa-miR-15a	CLIP-seq
MIRT1276217	hsa-miR-15b	CLIP-seq
MIRT1276218	hsa-miR-16	CLIP-seq
MIRT1276219	hsa-miR-195	CLIP-seq
MIRT1276220	hsa-miR-1972	CLIP-seq
MIRT1276221	hsa-miR-205	CLIP-seq
MIRT1276222	hsa-miR-2053	CLIP-seq
MIRT1276223	hsa-miR-223	CLIP-seq
MIRT1276224	hsa-miR-23a	CLIP-seq
MIRT1276225	hsa-miR-23b	CLIP-seq
MIRT1276226	hsa-miR-23c	CLIP-seq
MIRT1276227	hsa-miR-25	CLIP-seq
MIRT1276228	hsa-miR-27a	CLIP-seq
MIRT1276229	hsa-miR-27b	CLIP-seq
MIRT1276230	hsa-miR-3064-3p	CLIP-seq
MIRT1276231	hsa-miR-3065-3p	CLIP-seq
MIRT1276232	hsa-miR-3120-3p	CLIP-seq
MIRT1276233	hsa-miR-3121-3p	CLIP-seq
MIRT1276234	hsa-miR-3148	CLIP-seq
MIRT1276235	hsa-miR-3163	CLIP-seq
MIRT1276236	hsa-miR-3175	CLIP-seq
MIRT1276237	hsa-miR-3184	CLIP-seq
MIRT1276238	hsa-miR-32	CLIP-seq
MIRT1276239	hsa-miR-328	CLIP-seq
MIRT1276240	hsa-miR-33a	CLIP-seq
MIRT1276241	hsa-miR-33b	CLIP-seq
MIRT1276242	hsa-miR-34a	CLIP-seq
MIRT1276243	hsa-miR-34b	CLIP-seq
MIRT1276244	hsa-miR-34c-3p	CLIP-seq
MIRT1276245	hsa-miR-3606	CLIP-seq
MIRT1276246	hsa-miR-3609	CLIP-seq
MIRT1276247	hsa-miR-3616-5p	CLIP-seq
MIRT1276248	hsa-miR-3620	CLIP-seq
MIRT1276249	hsa-miR-363	CLIP-seq
MIRT1276250	hsa-miR-3647-3p	CLIP-seq
MIRT1276251	hsa-miR-3647-5p	CLIP-seq
MIRT1276252	hsa-miR-3649	CLIP-seq
MIRT1276253	hsa-miR-365	CLIP-seq
MIRT1276254	hsa-miR-3653	CLIP-seq
MIRT1276255	hsa-miR-3658	CLIP-seq
MIRT1276256	hsa-miR-3662	CLIP-seq
MIRT1276257	hsa-miR-3664-5p	CLIP-seq
MIRT1276258	hsa-miR-367	CLIP-seq
MIRT1276259	hsa-miR-3684	CLIP-seq
MIRT1276260	hsa-miR-376a	CLIP-seq
MIRT1276261	hsa-miR-376b	CLIP-seq
MIRT1276262	hsa-miR-3942-5p	CLIP-seq
MIRT1276263	hsa-miR-3973	CLIP-seq
MIRT1276264	hsa-miR-423-5p	CLIP-seq
MIRT1276265	hsa-miR-424	CLIP-seq
MIRT1276266	hsa-miR-4255	CLIP-seq
MIRT1276267	hsa-miR-4292	CLIP-seq
MIRT1276268	hsa-miR-4308	CLIP-seq
MIRT1276269	hsa-miR-4319	CLIP-seq
MIRT1276270	hsa-miR-4443	CLIP-seq
MIRT1276271	hsa-miR-4452	CLIP-seq
MIRT1276272	hsa-miR-4474-3p	CLIP-seq
MIRT1276273	hsa-miR-449b	CLIP-seq
MIRT1276274	hsa-miR-4539	CLIP-seq
MIRT1276275	hsa-miR-4650-5p	CLIP-seq
MIRT1276276	hsa-miR-4668-5p	CLIP-seq
MIRT1276277	hsa-miR-4680-3p	CLIP-seq
MIRT1276278	hsa-miR-4685-5p	CLIP-seq
MIRT1276279	hsa-miR-4700-3p	CLIP-seq
MIRT1276280	hsa-miR-4703-5p	CLIP-seq
MIRT1276281	hsa-miR-4710	CLIP-seq
MIRT1276282	hsa-miR-4711-5p	CLIP-seq
MIRT1276283	hsa-miR-4714-5p	CLIP-seq
MIRT1276284	hsa-miR-4715-3p	CLIP-seq
MIRT1276285	hsa-miR-4716-3p	CLIP-seq
MIRT1276286	hsa-miR-4751	CLIP-seq
MIRT1276287	hsa-miR-4760-3p	CLIP-seq
MIRT1276288	hsa-miR-4773	CLIP-seq
MIRT1276289	hsa-miR-4776-3p	CLIP-seq
MIRT1276290	hsa-miR-4789-3p	CLIP-seq
MIRT1276291	hsa-miR-4795-5p	CLIP-seq
MIRT1276292	hsa-miR-485-3p	CLIP-seq
MIRT1276293	hsa-miR-489	CLIP-seq
MIRT1276294	hsa-miR-497	CLIP-seq
MIRT1276295	hsa-miR-500a	CLIP-seq
MIRT1276296	hsa-miR-508-5p	CLIP-seq
MIRT1276297	hsa-miR-5095	CLIP-seq
MIRT1276298	hsa-miR-513a-5p	CLIP-seq
MIRT1276299	hsa-miR-514	CLIP-seq
MIRT1276300	hsa-miR-514b-3p	CLIP-seq
MIRT1276301	hsa-miR-520g	CLIP-seq
MIRT1276302	hsa-miR-520h	CLIP-seq
MIRT1276303	hsa-miR-532-5p	CLIP-seq
MIRT1276304	hsa-miR-539	CLIP-seq
MIRT1276305	hsa-miR-544b	CLIP-seq
MIRT1276306	hsa-miR-548a-5p	CLIP-seq
MIRT1276307	hsa-miR-548ab	CLIP-seq
MIRT1276308	hsa-miR-548ac	CLIP-seq
MIRT1276309	hsa-miR-548ad	CLIP-seq
MIRT1276310	hsa-miR-548ae	CLIP-seq
MIRT1276311	hsa-miR-548ah	CLIP-seq
MIRT1276312	hsa-miR-548aj	CLIP-seq
MIRT1276313	hsa-miR-548ak	CLIP-seq
MIRT1276314	hsa-miR-548am	CLIP-seq
MIRT1276315	hsa-miR-548b-5p	CLIP-seq
MIRT1276316	hsa-miR-548c-5p	CLIP-seq
MIRT1276317	hsa-miR-548d-3p	CLIP-seq
MIRT1276318	hsa-miR-548d-5p	CLIP-seq
MIRT1276319	hsa-miR-548h	CLIP-seq
MIRT1276320	hsa-miR-548i	CLIP-seq
MIRT1276321	hsa-miR-548j	CLIP-seq
MIRT1276322	hsa-miR-548t	CLIP-seq
MIRT1276323	hsa-miR-548w	CLIP-seq
MIRT1276324	hsa-miR-548x	CLIP-seq
MIRT1276325	hsa-miR-548y	CLIP-seq
MIRT1276326	hsa-miR-548z	CLIP-seq
MIRT1276327	hsa-miR-559	CLIP-seq
MIRT1276328	hsa-miR-569	CLIP-seq
MIRT1276329	hsa-miR-573	CLIP-seq
MIRT1276330	hsa-miR-582-5p	CLIP-seq
MIRT1276331	hsa-miR-586	CLIP-seq
MIRT1276332	hsa-miR-625	CLIP-seq
MIRT1276333	hsa-miR-642b	CLIP-seq
MIRT1276334	hsa-miR-708	CLIP-seq
MIRT1276335	hsa-miR-9	CLIP-seq
MIRT1276336	hsa-miR-92a	CLIP-seq
MIRT1276337	hsa-miR-92b	CLIP-seq
MIRT1276338	hsa-miR-935	CLIP-seq
MIRT1920840	hsa-miR-323-3p	CLIP-seq
MIRT1920841	hsa-miR-4729	CLIP-seq
MIRT1920842	hsa-miR-4764-3p	CLIP-seq
MIRT1920840	hsa-miR-323-3p	CLIP-seq
MIRT1920841	hsa-miR-4729	CLIP-seq
MIRT1920842	hsa-miR-4764-3p	CLIP-seq
MIRT2081218	hsa-miR-101	CLIP-seq
MIRT2081219	hsa-miR-1183	CLIP-seq
MIRT2081220	hsa-miR-1228	CLIP-seq
MIRT2081221	hsa-miR-1229	CLIP-seq
MIRT2081222	hsa-miR-1343	CLIP-seq
MIRT2081223	hsa-miR-139-5p	CLIP-seq
MIRT2081224	hsa-miR-144	CLIP-seq
MIRT2081225	hsa-miR-199a-3p	CLIP-seq
MIRT2081226	hsa-miR-199b-3p	CLIP-seq
MIRT2081227	hsa-miR-203	CLIP-seq
MIRT2081228	hsa-miR-204	CLIP-seq
MIRT1276221	hsa-miR-205	CLIP-seq
MIRT2081229	hsa-miR-211	CLIP-seq
MIRT2081230	hsa-miR-2110	CLIP-seq
MIRT2081231	hsa-miR-221	CLIP-seq
MIRT2081232	hsa-miR-222	CLIP-seq
MIRT1276228	hsa-miR-27a	CLIP-seq
MIRT1276229	hsa-miR-27b	CLIP-seq
MIRT2081233	hsa-miR-28-3p	CLIP-seq
MIRT2081234	hsa-miR-297	CLIP-seq
MIRT1276230	hsa-miR-3064-3p	CLIP-seq
MIRT2081235	hsa-miR-3074-5p	CLIP-seq
MIRT2081236	hsa-miR-3117-5p	CLIP-seq
MIRT1276232	hsa-miR-3120-3p	CLIP-seq
MIRT2081237	hsa-miR-3129-5p	CLIP-seq
MIRT1276234	hsa-miR-3148	CLIP-seq
MIRT2081238	hsa-miR-3150a-3p	CLIP-seq
MIRT1276235	hsa-miR-3163	CLIP-seq
MIRT2081239	hsa-miR-3166	CLIP-seq
MIRT2081240	hsa-miR-3167	CLIP-seq
MIRT2081241	hsa-miR-3173-3p	CLIP-seq
MIRT2081242	hsa-miR-3192	CLIP-seq
MIRT2081243	hsa-miR-329	CLIP-seq
MIRT2081244	hsa-miR-342-3p	CLIP-seq
MIRT1276244	hsa-miR-34c-3p	CLIP-seq
MIRT2081245	hsa-miR-3612	CLIP-seq
MIRT2081246	hsa-miR-361-3p	CLIP-seq
MIRT1276247	hsa-miR-3616-5p	CLIP-seq
MIRT2081247	hsa-miR-362-3p	CLIP-seq
MIRT1276250	hsa-miR-3647-3p	CLIP-seq
MIRT1276251	hsa-miR-3647-5p	CLIP-seq
MIRT1276252	hsa-miR-3649	CLIP-seq
MIRT1276256	hsa-miR-3662	CLIP-seq
MIRT2081248	hsa-miR-3689a-3p	CLIP-seq
MIRT2081249	hsa-miR-3689c	CLIP-seq
MIRT2081250	hsa-miR-3692	CLIP-seq
MIRT2081251	hsa-miR-370	CLIP-seq
MIRT1276260	hsa-miR-376a	CLIP-seq
MIRT1276261	hsa-miR-376b	CLIP-seq
MIRT2081252	hsa-miR-3941	CLIP-seq
MIRT2081253	hsa-miR-409-3p	CLIP-seq
MIRT2081254	hsa-miR-4252	CLIP-seq
MIRT1276266	hsa-miR-4255	CLIP-seq
MIRT2081255	hsa-miR-4260	CLIP-seq
MIRT2081256	hsa-miR-4271	CLIP-seq
MIRT2081257	hsa-miR-4313	CLIP-seq
MIRT2081258	hsa-miR-4423-5p	CLIP-seq
MIRT1276270	hsa-miR-4443	CLIP-seq
MIRT1276271	hsa-miR-4452	CLIP-seq
MIRT2081259	hsa-miR-4502	CLIP-seq
MIRT2081260	hsa-miR-452	CLIP-seq
MIRT2081261	hsa-miR-4533	CLIP-seq
MIRT1276274	hsa-miR-4539	CLIP-seq
MIRT2081262	hsa-miR-4639-5p	CLIP-seq
MIRT1276276	hsa-miR-4668-5p	CLIP-seq
MIRT2081263	hsa-miR-4676-3p	CLIP-seq
MIRT2081264	hsa-miR-4676-5p	CLIP-seq
MIRT1276277	hsa-miR-4680-3p	CLIP-seq
MIRT1276278	hsa-miR-4685-5p	CLIP-seq
MIRT2081265	hsa-miR-4691-3p	CLIP-seq
MIRT1276279	hsa-miR-4700-3p	CLIP-seq
MIRT1276284	hsa-miR-4715-3p	CLIP-seq
MIRT1276285	hsa-miR-4716-3p	CLIP-seq
MIRT2081266	hsa-miR-4719	CLIP-seq
MIRT2081267	hsa-miR-4725-3p	CLIP-seq
MIRT2081268	hsa-miR-4727-5p	CLIP-seq
MIRT2081269	hsa-miR-4728-5p	CLIP-seq
MIRT2081270	hsa-miR-4747-5p	CLIP-seq
MIRT1276287	hsa-miR-4760-3p	CLIP-seq
MIRT2081271	hsa-miR-4766-5p	CLIP-seq
MIRT2081272	hsa-miR-4769-3p	CLIP-seq
MIRT2081273	hsa-miR-4774-3p	CLIP-seq
MIRT1276290	hsa-miR-4789-3p	CLIP-seq
MIRT1276291	hsa-miR-4795-5p	CLIP-seq
MIRT2081274	hsa-miR-498	CLIP-seq
MIRT1276296	hsa-miR-508-5p	CLIP-seq
MIRT1276297	hsa-miR-5095	CLIP-seq
MIRT1276298	hsa-miR-513a-5p	CLIP-seq
MIRT2081275	hsa-miR-544	CLIP-seq
MIRT1276309	hsa-miR-548ad	CLIP-seq
MIRT1276322	hsa-miR-548t	CLIP-seq
MIRT2081276	hsa-miR-548v	CLIP-seq
MIRT2081277	hsa-miR-567	CLIP-seq
MIRT2081278	hsa-miR-570	CLIP-seq
MIRT1276329	hsa-miR-573	CLIP-seq
MIRT2081279	hsa-miR-575	CLIP-seq
MIRT1276330	hsa-miR-582-5p	CLIP-seq
MIRT2081280	hsa-miR-587	CLIP-seq
MIRT2081281	hsa-miR-603	CLIP-seq
MIRT2081282	hsa-miR-604	CLIP-seq
MIRT2081283	hsa-miR-616	CLIP-seq
MIRT1276332	hsa-miR-625	CLIP-seq
MIRT1276333	hsa-miR-642b	CLIP-seq
MIRT2081284	hsa-miR-647	CLIP-seq
MIRT2081285	hsa-miR-650	CLIP-seq
MIRT2081286	hsa-miR-876-5p	CLIP-seq
MIRT1276335	hsa-miR-9	CLIP-seq
MIRT2081287	hsa-miR-924	CLIP-seq
MIRT2081288	hsa-miR-943	CLIP-seq
MIRT2307125	hsa-miR-1178	CLIP-seq
MIRT2307126	hsa-miR-1197	CLIP-seq
MIRT2081220	hsa-miR-1228	CLIP-seq
MIRT2081221	hsa-miR-1229	CLIP-seq
MIRT2307127	hsa-miR-124	CLIP-seq
MIRT2307128	hsa-miR-1245b-3p	CLIP-seq
MIRT2307129	hsa-miR-1257	CLIP-seq
MIRT1276210	hsa-miR-1268	CLIP-seq
MIRT1276211	hsa-miR-1268b	CLIP-seq
MIRT1276212	hsa-miR-1279	CLIP-seq
MIRT2307130	hsa-miR-128	CLIP-seq
MIRT2307131	hsa-miR-1289	CLIP-seq
MIRT1276213	hsa-miR-1291	CLIP-seq
MIRT1276214	hsa-miR-1294	CLIP-seq
MIRT2307132	hsa-miR-132	CLIP-seq
MIRT2307133	hsa-miR-135a	CLIP-seq
MIRT2307134	hsa-miR-135b	CLIP-seq
MIRT2081224	hsa-miR-144	CLIP-seq
MIRT1276216	hsa-miR-15a	CLIP-seq
MIRT1276217	hsa-miR-15b	CLIP-seq
MIRT1276218	hsa-miR-16	CLIP-seq
MIRT2307135	hsa-miR-1825	CLIP-seq
MIRT1276219	hsa-miR-195	CLIP-seq
MIRT2307136	hsa-miR-199a-5p	CLIP-seq
MIRT2307137	hsa-miR-199b-5p	CLIP-seq
MIRT1276221	hsa-miR-205	CLIP-seq
MIRT2081230	hsa-miR-2110	CLIP-seq
MIRT2307138	hsa-miR-212	CLIP-seq
MIRT1276224	hsa-miR-23a	CLIP-seq
MIRT1276225	hsa-miR-23b	CLIP-seq
MIRT1276226	hsa-miR-23c	CLIP-seq
MIRT1276227	hsa-miR-25	CLIP-seq
MIRT1276228	hsa-miR-27a	CLIP-seq
MIRT1276229	hsa-miR-27b	CLIP-seq
MIRT2081234	hsa-miR-297	CLIP-seq
MIRT1276230	hsa-miR-3064-3p	CLIP-seq
MIRT2307139	hsa-miR-3065-5p	CLIP-seq
MIRT2081236	hsa-miR-3117-5p	CLIP-seq
MIRT2307140	hsa-miR-3119	CLIP-seq
MIRT1276232	hsa-miR-3120-3p	CLIP-seq
MIRT2307141	hsa-miR-3126-5p	CLIP-seq
MIRT2081238	hsa-miR-3150a-3p	CLIP-seq
MIRT1276235	hsa-miR-3163	CLIP-seq
MIRT2307142	hsa-miR-3168	CLIP-seq
MIRT2081241	hsa-miR-3173-3p	CLIP-seq
MIRT1276237	hsa-miR-3184	CLIP-seq
MIRT2307143	hsa-miR-3198	CLIP-seq
MIRT1276238	hsa-miR-32	CLIP-seq
MIRT1276239	hsa-miR-328	CLIP-seq
MIRT2081243	hsa-miR-329	CLIP-seq
MIRT2081244	hsa-miR-342-3p	CLIP-seq
MIRT2307144	hsa-miR-342-5p	CLIP-seq
MIRT1276243	hsa-miR-34b	CLIP-seq
MIRT1276244	hsa-miR-34c-3p	CLIP-seq
MIRT1276245	hsa-miR-3606	CLIP-seq
MIRT2307145	hsa-miR-3607-5p	CLIP-seq
MIRT1276247	hsa-miR-3616-5p	CLIP-seq
MIRT2081247	hsa-miR-362-3p	CLIP-seq
MIRT1276249	hsa-miR-363	CLIP-seq
MIRT1276250	hsa-miR-3647-3p	CLIP-seq
MIRT1276251	hsa-miR-3647-5p	CLIP-seq
MIRT2307146	hsa-miR-3652	CLIP-seq
MIRT1276258	hsa-miR-367	CLIP-seq
MIRT2307147	hsa-miR-3907	CLIP-seq
MIRT2307148	hsa-miR-3940-5p	CLIP-seq
MIRT2081252	hsa-miR-3941	CLIP-seq
MIRT2307149	hsa-miR-3943	CLIP-seq
MIRT2081253	hsa-miR-409-3p	CLIP-seq
MIRT2307150	hsa-miR-421	CLIP-seq
MIRT1276264	hsa-miR-423-5p	CLIP-seq
MIRT1276265	hsa-miR-424	CLIP-seq
MIRT1276266	hsa-miR-4255	CLIP-seq
MIRT2081255	hsa-miR-4260	CLIP-seq
MIRT2081256	hsa-miR-4271	CLIP-seq
MIRT2307151	hsa-miR-4275	CLIP-seq
MIRT2307152	hsa-miR-4286	CLIP-seq
MIRT2307153	hsa-miR-4294	CLIP-seq
MIRT2307154	hsa-miR-4309	CLIP-seq
MIRT2081257	hsa-miR-4313	CLIP-seq
MIRT2307155	hsa-miR-4318	CLIP-seq
MIRT2307156	hsa-miR-4323	CLIP-seq
MIRT2307157	hsa-miR-4326	CLIP-seq
MIRT2081258	hsa-miR-4423-5p	CLIP-seq
MIRT2307158	hsa-miR-4430	CLIP-seq
MIRT2307159	hsa-miR-4433	CLIP-seq
MIRT2307160	hsa-miR-4436a	CLIP-seq
MIRT1276270	hsa-miR-4443	CLIP-seq
MIRT1276271	hsa-miR-4452	CLIP-seq
MIRT2307161	hsa-miR-4459	CLIP-seq
MIRT2307162	hsa-miR-4506	CLIP-seq
MIRT2307163	hsa-miR-4507	CLIP-seq
MIRT2081261	hsa-miR-4533	CLIP-seq
MIRT1276274	hsa-miR-4539	CLIP-seq
MIRT2307164	hsa-miR-455-5p	CLIP-seq
MIRT2307165	hsa-miR-4664-5p	CLIP-seq
MIRT2081264	hsa-miR-4676-5p	CLIP-seq
MIRT1276277	hsa-miR-4680-3p	CLIP-seq
MIRT2081265	hsa-miR-4691-3p	CLIP-seq
MIRT2307166	hsa-miR-4695-5p	CLIP-seq
MIRT1276279	hsa-miR-4700-3p	CLIP-seq
MIRT2307167	hsa-miR-4704-3p	CLIP-seq
MIRT2307168	hsa-miR-4709-5p	CLIP-seq
MIRT1276281	hsa-miR-4710	CLIP-seq
MIRT1276282	hsa-miR-4711-5p	CLIP-seq
MIRT1276284	hsa-miR-4715-3p	CLIP-seq
MIRT2081266	hsa-miR-4719	CLIP-seq
MIRT2081267	hsa-miR-4725-3p	CLIP-seq
MIRT2307169	hsa-miR-4742-3p	CLIP-seq
MIRT2081270	hsa-miR-4747-5p	CLIP-seq
MIRT1276287	hsa-miR-4760-3p	CLIP-seq
MIRT2307170	hsa-miR-4768-3p	CLIP-seq
MIRT1276288	hsa-miR-4773	CLIP-seq
MIRT2307171	hsa-miR-4779	CLIP-seq
MIRT1276290	hsa-miR-4789-3p	CLIP-seq
MIRT1276291	hsa-miR-4795-5p	CLIP-seq
MIRT2307172	hsa-miR-483-3p	CLIP-seq
MIRT1276292	hsa-miR-485-3p	CLIP-seq
MIRT2307173	hsa-miR-485-5p	CLIP-seq
MIRT1276294	hsa-miR-497	CLIP-seq
MIRT1276295	hsa-miR-500a	CLIP-seq
MIRT2307174	hsa-miR-506	CLIP-seq
MIRT1276296	hsa-miR-508-5p	CLIP-seq
MIRT1276297	hsa-miR-5095	CLIP-seq
MIRT1276298	hsa-miR-513a-5p	CLIP-seq
MIRT2307175	hsa-miR-513c	CLIP-seq
MIRT2307176	hsa-miR-514b-5p	CLIP-seq
MIRT2307177	hsa-miR-548aa	CLIP-seq
MIRT1276308	hsa-miR-548ac	CLIP-seq
MIRT1276309	hsa-miR-548ad	CLIP-seq
MIRT1276310	hsa-miR-548ae	CLIP-seq
MIRT1276312	hsa-miR-548aj	CLIP-seq
MIRT1276314	hsa-miR-548am	CLIP-seq
MIRT2307178	hsa-miR-548an	CLIP-seq
MIRT1276317	hsa-miR-548d-3p	CLIP-seq
MIRT1276322	hsa-miR-548t	CLIP-seq
MIRT1276324	hsa-miR-548x	CLIP-seq
MIRT1276326	hsa-miR-548z	CLIP-seq
MIRT2081277	hsa-miR-567	CLIP-seq
MIRT1276329	hsa-miR-573	CLIP-seq
MIRT2081279	hsa-miR-575	CLIP-seq
MIRT1276330	hsa-miR-582-5p	CLIP-seq
MIRT1276331	hsa-miR-586	CLIP-seq
MIRT2307179	hsa-miR-597	CLIP-seq
MIRT2081281	hsa-miR-603	CLIP-seq
MIRT2307180	hsa-miR-607	CLIP-seq
MIRT2081283	hsa-miR-616	CLIP-seq
MIRT1276333	hsa-miR-642b	CLIP-seq
MIRT2307181	hsa-miR-665	CLIP-seq
MIRT2307182	hsa-miR-7	CLIP-seq
MIRT1276336	hsa-miR-92a	CLIP-seq
MIRT1276337	hsa-miR-92b	CLIP-seq
MIRT2307133	hsa-miR-135a	CLIP-seq
MIRT2307134	hsa-miR-135b	CLIP-seq
MIRT1276228	hsa-miR-27a	CLIP-seq
MIRT1276229	hsa-miR-27b	CLIP-seq
MIRT1276230	hsa-miR-3064-3p	CLIP-seq
MIRT2081236	hsa-miR-3117-5p	CLIP-seq
MIRT1276232	hsa-miR-3120-3p	CLIP-seq
MIRT2081239	hsa-miR-3166	CLIP-seq
MIRT1276244	hsa-miR-34c-3p	CLIP-seq
MIRT1276247	hsa-miR-3616-5p	CLIP-seq
MIRT1276251	hsa-miR-3647-5p	CLIP-seq
MIRT1276266	hsa-miR-4255	CLIP-seq
MIRT2307157	hsa-miR-4326	CLIP-seq
MIRT1276271	hsa-miR-4452	CLIP-seq
MIRT2081264	hsa-miR-4676-5p	CLIP-seq
MIRT1276277	hsa-miR-4680-3p	CLIP-seq
MIRT1276284	hsa-miR-4715-3p	CLIP-seq
MIRT1276290	hsa-miR-4789-3p	CLIP-seq
MIRT1276291	hsa-miR-4795-5p	CLIP-seq
MIRT1276298	hsa-miR-513a-5p	CLIP-seq
MIRT1276329	hsa-miR-573	CLIP-seq
MIRT2081279	hsa-miR-575	CLIP-seq
MIRT2081282	hsa-miR-604	CLIP-seq
MIRT2081284	hsa-miR-647	CLIP-seq
MIRT1276250	hsa-miR-3647-3p	CLIP-seq
MIRT1276279	hsa-miR-4700-3p	CLIP-seq
MIRT1276297	hsa-miR-5095	CLIP-seq
MIRT1276330	hsa-miR-582-5p	CLIP-seq
MIRT2604661	hsa-miR-1227	CLIP-seq
MIRT2604662	hsa-miR-3130-3p	CLIP-seq
MIRT2604663	hsa-miR-3650	CLIP-seq
MIRT2307164	hsa-miR-455-5p	CLIP-seq
MIRT2604664	hsa-miR-4659a-5p	CLIP-seq
MIRT2604665	hsa-miR-4659b-5p	CLIP-seq
MIRT2604666	hsa-miR-4666-5p	CLIP-seq
MIRT2604667	hsa-miR-4716-5p	CLIP-seq
MIRT1920842	hsa-miR-4764-3p	CLIP-seq
MIRT2604668	hsa-miR-4781-3p	CLIP-seq
MIRT2604669	hsa-miR-660	CLIP-seq
MIRT2604662	hsa-miR-3130-3p	CLIP-seq
MIRT2604663	hsa-miR-3650	CLIP-seq
MIRT2604664	hsa-miR-4659a-5p	CLIP-seq
MIRT2604665	hsa-miR-4659b-5p	CLIP-seq
MIRT2604667	hsa-miR-4716-5p	CLIP-seq
MIRT2604668	hsa-miR-4781-3p	CLIP-seq
MIRT2604669	hsa-miR-660	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001772	Component	Immunological synapse	IDA	12913111
GO:0001772	Component	Immunological synapse	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	9531590, 10821867, 12913111, 18348712, 18936167, 19332538
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IMP	9780142, 12475979
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	10821867
GO:0005515	Function	Protein binding	IPI	10821867, 12370829, 12475979, 12771128, 16893970, 18936167, 19167335, 19494114
GO:0005576	Component	Extracellular region	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005886	Component	Plasma membrane	IDA	9531590, 18348712, 19836242
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7937872
GO:0005911	Component	Cell-cell junction	IDA	12370829, 19332538
GO:0007165	Process	Signal transduction	IBA
GO:0007411	Process	Axon guidance	IBA
GO:0007507	Process	Heart development	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0008013	Function	Beta-catenin binding	IPI	12370829
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	14709717, 16682945
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009986	Component	Cell surface	IDA	12913111
GO:0010572	Process	Positive regulation of platelet activation	IEA
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	14709717
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IDA	12062403, 12370829, 19494114
GO:0016791	Function	Phosphatase activity	IMP	11259588, 19836242
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	IPI	19332538
GO:0030054	Component	Cell junction	IDA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030155	Process	Regulation of cell adhesion	IMP	12370829
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030220	Process	Platelet formation	IMP	30591527
GO:0030308	Process	Negative regulation of cell growth	IDA	14709717
GO:0030336	Process	Negative regulation of cell migration	IDA	16682945
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IDA	9531590, 10821867, 12913111, 18348712, 18936167, 19332538
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IMP	9780142, 12475979
GO:0035579	Component	Specific granule membrane	TAS
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IMP	19836242
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043116	Process	Negative regulation of vascular permeability	IDA	19332538
GO:0043407	Process	Negative regulation of MAP kinase activity	IDA	19494114
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045295	Function	Gamma-catenin binding	IPI	12370829
GO:0045296	Function	Cadherin binding	IEA
GO:0045296	Function	Cadherin binding	IPI	28926625
GO:0045785	Process	Positive regulation of cell adhesion	IMP	21091576
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IMP	21091576
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050778	Process	Positive regulation of immune response	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	ISS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	12913111
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IMP	9780142, 11259588
GO:0050918	Process	Positive chemotaxis	IDA	14709717
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	19494114
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	21091576
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	18936167
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19922411
GO:0060242	Process	Contact inhibition	NAS	7937872
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	IEA
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	ISS	18249142
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070097	Function	Delta-catenin binding	IPI	12370829, 19332538
GO:0070161	Component	Anchoring junction	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA

Other IDs

• MIM: 600925
• HGNC: 9673
• e!Ensembl: ENSG00000149177

Protein

• UniProt ID: Q12913
• Protein name: Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148)
• Protein function: Tyrosine phosphatase which dephosphorylates or contributes to the dephosphorylation of CTNND1, FLT3, PDGFRB, MET, KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1 and PIK3R2 (PubMed:10821867, PubMed:12062403, PubMed:12370829, PubMed:1247597
• PDB: 2CFV, 2DLE, 2NZ6, 7U01, 7U08
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00041	fn3	120 → 199	Fibronectin type III domain	Domain
  PF00041	fn3	368 → 445	Fibronectin type III domain	Domain
  PF18861	PTP_tm	835 → 1000	Transmembrane domain of protein tyrosine phosphatase, receptor type J	Family
  PF00102	Y_phosphatase	1065 → 1297	Protein-tyrosine phosphatase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the promyelocytic cell line HL-60, the granulocyte-macrophage colony-stimulating factor-dependent leukemic cell line F-36P, and the IL3 and erythropoietin-dependent leukemic cell line F-36E. Expressed predominantly in epit
• Sequence:

  MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQ
  ISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPS
  PVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPAT
  SYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLL
  ESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR
  AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAI
  EFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV
  IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAE
  SFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVP
  SAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGT
  LYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLL
  IEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPA
  SMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEV
  TYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGF
  EASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSE
  VLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRY
  SDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKL
  IRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDIS
  RVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTK
  CVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
  TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIE
  NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIY
  ENLAPVTTFGKTNGYIA

• Sequence length: 1337

Associated diseases

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Carcinoma of colon	Pathogenic	rs121434507	RCV000009226
Thrombocytopenia 10	Pathogenic	rs758226104, rs2495194878	RCV003324883 RCV003324884

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Clear cell carcinoma of kidney	Benign	rs61737868, rs61739249	RCV005903643 RCV005910393
Colorectal cancer	Conflicting classifications of pathogenicity	rs1566734	RCV002490345
Hepatocellular carcinoma	Benign	rs61737868	RCV005903642
Malignant tumor of esophagus	Benign	rs61739249	RCV005910392
PTPRJ-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	rs1566734, rs756013780, rs2134339122, rs747484779, rs2495125984, rs750413569, rs1183346651, rs2495150901, rs200255695, rs537257163, rs2495213736, rs1190422297, rs201977385, rs371234967, rs143897534, rs749215508, rs748064728, rs559753032, rs751658749, rs151256577, rs141853869, rs142074473, rs114829238, rs141578400, rs192553053, rs140686417, rs748897376, rs201873108, rs35920791, rs534721017, rs61739249	RCV003974812 RCV003906670 RCV003404311 RCV003400491 RCV003418984 RCV003392941 RCV003896756 RCV003896999 RCV003907109 RCV003964646 RCV003974664 RCV003982712 RCV003906832 RCV003904389 RCV003911941 RCV003912284 RCV003977176 RCV003959694 RCV003971881 RCV003919475 RCV003931577 RCV003949825 RCV003917390 RCV003951529 RCV003951531 RCV003957055 RCV003954507 RCV003964717 RCV003964744 RCV003961999 RCV003897959

Associations from Text Mining
Disease Name	Relationship Type	References
Asthma	Associate	39380119
Breast Neoplasms	Associate	12475979, 9115287
Cachexia	Associate	27879288
Carcinogenesis	Associate	20823296, 22076464
Carcinoma Renal Cell	Associate	23007793
Carcinoma Squamous Cell	Associate	34791835
Carcinoma Squamous Cell	Inhibit	35791609
Colorectal Neoplasms	Associate	16258161, 24338422, 28031238
Esophageal Neoplasms	Inhibit	26694178
Esophageal Squamous Cell Carcinoma	Associate	26694178, 36578050
Frailty	Associate	26248682
Glaucoma	Associate	39342991
Glioblastoma	Associate	34301218
Glioma	Associate	15123617, 28052032
Insulin Resistance	Associate	27535281
Lymphoma B Cell	Associate	23341091, 24885312
Lymphoma Follicular	Associate	23341091, 24885312
Lymphoma Large B Cell Diffuse	Associate	24885312
Lymphoma Non Hodgkin	Associate	23341091, 24885312
Mitral Valve Prolapse	Associate	29762926
Neoplasms	Inhibit	12475979, 19494114, 19836242, 20823296, 22898603, 23341091, 26694178, 28052032, 34791835, 35791609
Neoplasms	Associate	15123617, 16258161, 19922411, 32233832, 34791835, 37515426, 40028213, 9115287
Thrombasthenia Thrombocytopenia Hereditary	Associate	30898775
Thyroid Cancer Papillary	Associate	20823296
Uterine Cervical Neoplasms	Associate	35791609