PSME1 (proteasome activator subunit 1)

Gene

• Entrez ID: 5720
• Gene name: Proteasome activator subunit 1
• Gene symbol: PSME1
• Synonyms (NCBI Gene): HEL-S-129m, IFI5111, PA28A, PA28alpha, REGalpha
• Chromosome: 14
• Chromosome location: 14q12
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023950	hsa-miR-1-3p	Proteomics	18668040
MIRT029951	hsa-miR-26b-5p	Microarray	19088304
MIRT045261	hsa-miR-186-5p	CLASH	23622248
MIRT043440	hsa-miR-331-3p	CLASH	23622248
MIRT043135	hsa-miR-324-5p	CLASH	23622248
MIRT039420	hsa-miR-421	CLASH	23622248
MIRT1270744	hsa-miR-185	CLIP-seq
MIRT1270745	hsa-miR-4257	CLIP-seq
MIRT1270746	hsa-miR-4270	CLIP-seq
MIRT1270747	hsa-miR-4306	CLIP-seq
MIRT1270748	hsa-miR-4441	CLIP-seq
MIRT1270749	hsa-miR-4644	CLIP-seq
MIRT1270750	hsa-miR-4704-3p	CLIP-seq
MIRT1270751	hsa-miR-4721	CLIP-seq
MIRT2305941	hsa-miR-1289	CLIP-seq
MIRT1270744	hsa-miR-185	CLIP-seq
MIRT2305942	hsa-miR-2110	CLIP-seq
MIRT2305943	hsa-miR-216a	CLIP-seq
MIRT2305944	hsa-miR-2355-5p	CLIP-seq
MIRT2305945	hsa-miR-3150a-3p	CLIP-seq
MIRT2305946	hsa-miR-3198	CLIP-seq
MIRT2305947	hsa-miR-4260	CLIP-seq
MIRT2305948	hsa-miR-4294	CLIP-seq
MIRT1270747	hsa-miR-4306	CLIP-seq
MIRT2305949	hsa-miR-4309	CLIP-seq
MIRT2305950	hsa-miR-4476	CLIP-seq
MIRT1270749	hsa-miR-4644	CLIP-seq
MIRT2305951	hsa-miR-4709-5p	CLIP-seq
MIRT2305952	hsa-miR-4718	CLIP-seq
MIRT2305953	hsa-miR-493	CLIP-seq
MIRT2305954	hsa-miR-516b	CLIP-seq
MIRT2305955	hsa-miR-593	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	TAS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008537	Component	Proteasome activator complex	IEA
GO:0010950	Process	Positive regulation of endopeptidase activity	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061133	Function	Endopeptidase activator activity	IBA	21873635
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IBA	21873635
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IBA	21873635

Other IDs

• MIM: 600654
• HGNC: 9568
• e!Ensembl: ENSG00000092010

Protein

• UniProt ID: Q06323
• Protein name: Proteasome activator complex subunit 1 (11S regulator complex subunit alpha) (REG-alpha) (Activator of multicatalytic protease subunit 1) (Interferon gamma up-regulated I-5111 protein) (IGUP I-5111) (Proteasome activator 28 subunit alpha) (PA28a) (PA28alp
• Protein function: Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
• PDB: 1AVO, 7DR6, 7DRW, 7NAO, 7NAP, 8CXB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02251	PA28_alpha	8 → 68	Proteasome activator pa28 alpha subunit	Family
  PF02252	PA28_beta	103 → 247	Proteasome activator pa28 beta subunit	Family

• Sequence:

  MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
  LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPE
  IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE
  RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKP
  RGETKGMIY

• Sequence length: 249