PSME1 (proteasome activator subunit 1)

Gene

• Entrez ID: 5720
• Gene name: Proteasome activator subunit 1
• Gene symbol: PSME1
• Synonyms (NCBI Gene): HEL-S-129m, IFI5111, PA28A, PA28alpha, REGalpha
• Chromosome: 14
• Chromosome location: 14q12
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023950	hsa-miR-1-3p	Proteomics	18668040
MIRT029951	hsa-miR-26b-5p	Microarray	19088304
MIRT045261	hsa-miR-186-5p	CLASH	23622248
MIRT043440	hsa-miR-331-3p	CLASH	23622248
MIRT043135	hsa-miR-324-5p	CLASH	23622248
MIRT039420	hsa-miR-421	CLASH	23622248
MIRT1270744	hsa-miR-185	CLIP-seq
MIRT1270745	hsa-miR-4257	CLIP-seq
MIRT1270746	hsa-miR-4270	CLIP-seq
MIRT1270747	hsa-miR-4306	CLIP-seq
MIRT1270748	hsa-miR-4441	CLIP-seq
MIRT1270749	hsa-miR-4644	CLIP-seq
MIRT1270750	hsa-miR-4704-3p	CLIP-seq
MIRT1270751	hsa-miR-4721	CLIP-seq
MIRT2305941	hsa-miR-1289	CLIP-seq
MIRT1270744	hsa-miR-185	CLIP-seq
MIRT2305942	hsa-miR-2110	CLIP-seq
MIRT2305943	hsa-miR-216a	CLIP-seq
MIRT2305944	hsa-miR-2355-5p	CLIP-seq
MIRT2305945	hsa-miR-3150a-3p	CLIP-seq
MIRT2305946	hsa-miR-3198	CLIP-seq
MIRT2305947	hsa-miR-4260	CLIP-seq
MIRT2305948	hsa-miR-4294	CLIP-seq
MIRT1270747	hsa-miR-4306	CLIP-seq
MIRT2305949	hsa-miR-4309	CLIP-seq
MIRT2305950	hsa-miR-4476	CLIP-seq
MIRT1270749	hsa-miR-4644	CLIP-seq
MIRT2305951	hsa-miR-4709-5p	CLIP-seq
MIRT2305952	hsa-miR-4718	CLIP-seq
MIRT2305953	hsa-miR-493	CLIP-seq
MIRT2305954	hsa-miR-516b	CLIP-seq
MIRT2305955	hsa-miR-593	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	16189514, 32296183, 32814053, 33961781, 35271311
GO:0005654	Component	Nucleoplasm	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	TAS
GO:0008537	Component	Proteasome activator complex	IEA
GO:0019884	Process	Antigen processing and presentation of exogenous antigen	IEA
GO:0061133	Function	Endopeptidase activator activity	IBA
GO:0061133	Function	Endopeptidase activator activity	IEA
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IBA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IBA

Other IDs

• MIM: 600654
• HGNC: 9568
• e!Ensembl: ENSG00000092010

Protein

• UniProt ID: Q06323
• Protein name: Proteasome activator complex subunit 1 (11S regulator complex subunit alpha) (REG-alpha) (Activator of multicatalytic protease subunit 1) (Interferon gamma up-regulated I-5111 protein) (IGUP I-5111) (Proteasome activator 28 subunit alpha) (PA28a) (PA28alp
• Protein function: Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
• PDB: 1AVO, 7DR6, 7DRW, 7NAO, 7NAP, 8CXB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02251	PA28_alpha	8 → 68	Proteasome activator pa28 alpha subunit	Family
  PF02252	PA28_beta	103 → 247	Proteasome activator pa28 beta subunit	Family

• Sequence:

  MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
  LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPE
  IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE
  RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKP
  RGETKGMIY

• Sequence length: 249

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Adrenocortical carcinoma, hereditary	Likely benign	rs150529650	RCV005933124
Cervical cancer	Likely benign	rs150529650	RCV005933125
Clear cell carcinoma of kidney	Likely benign	rs150529650	RCV005933126
Colon adenocarcinoma	Likely benign	rs150529650	RCV005933122
Colorectal cancer	Likely benign	rs150529650	RCV005933127
Familial cancer of breast	Likely benign	rs150529650	RCV005933121
Gastric cancer	Likely benign	rs150529650	RCV005933129
Hepatocellular carcinoma	Likely benign	rs150529650	RCV005933123
Ovarian serous cystadenocarcinoma	Likely benign	rs150529650	RCV005933130
Sarcoma	Likely benign	rs150529650	RCV005933128
Thyroid cancer, nonmedullary, 1	Likely benign	rs150529650	RCV005933131

Associations from Text Mining
Disease Name	Relationship Type	References
AA amyloidosis	Inhibit	14997933
Alzheimer Disease	Associate	39392298
Arthritis Gouty	Associate	39511617
Arthritis Rheumatoid	Stimulate	34812532
Arthritis Rheumatoid	Associate	39342401
Autoimmune Diseases of the Nervous System	Associate	16414974
Diabetes Mellitus Type 2	Associate	39342401
Esophageal Squamous Cell Carcinoma	Associate	21517111
Gastritis Atrophic	Inhibit	22370706
Inflammation	Associate	39511617
Multiple Myeloma	Associate	33318477
Neoplasms	Associate	36700205
Ovarian Neoplasms	Associate	20671603
Squamous Cell Carcinoma of Head and Neck	Stimulate	19691830