Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5714
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, non-ATPase 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMD8
Synonyms (NCBI Gene) Gene synonyms aliases	HEL-S-91n, HIP6, HYPF, Nin1p, Rpn12, S14, p31
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048193	hsa-miR-196a-5p	CLASH	23622248
MIRT045550	hsa-miR-149-5p	CLASH	23622248
MIRT045234	hsa-miR-186-5p	CLASH	23622248
MIRT042550	hsa-miR-423-3p	CLASH	23622248
MIRT041805	hsa-miR-484	CLASH	23622248
MIRT040097	hsa-miR-615-3p	CLASH	23622248
MIRT039343	hsa-miR-425-5p	CLASH	23622248
MIRT1270688	hsa-miR-10a	CLIP-seq
MIRT1270689	hsa-miR-10b	CLIP-seq
MIRT1270690	hsa-miR-1263	CLIP-seq
MIRT1270691	hsa-miR-4490	CLIP-seq
MIRT1270692	hsa-miR-4774-5p	CLIP-seq
MIRT1270693	hsa-miR-548c-3p	CLIP-seq
MIRT1270694	hsa-miR-653	CLIP-seq
MIRT1552661	hsa-miR-4758-3p	CLIP-seq
MIRT2079563	hsa-miR-1197	CLIP-seq
MIRT2079564	hsa-miR-1205	CLIP-seq
MIRT2079565	hsa-miR-128	CLIP-seq
MIRT2079566	hsa-miR-1972	CLIP-seq
MIRT2079567	hsa-miR-1976	CLIP-seq
MIRT2079568	hsa-miR-3140-5p	CLIP-seq
MIRT2079569	hsa-miR-3612	CLIP-seq
MIRT2079570	hsa-miR-365	CLIP-seq
MIRT2079571	hsa-miR-3975	CLIP-seq
MIRT2079572	hsa-miR-4420	CLIP-seq
MIRT2079573	hsa-miR-4443	CLIP-seq
MIRT2079574	hsa-miR-4717-5p	CLIP-seq
MIRT2079575	hsa-miR-4729	CLIP-seq
MIRT2079576	hsa-miR-4731-5p	CLIP-seq
MIRT2079577	hsa-miR-4760-3p	CLIP-seq
MIRT2079578	hsa-miR-512-3p	CLIP-seq
MIRT2079579	hsa-miR-515-5p	CLIP-seq
MIRT2079580	hsa-miR-650	CLIP-seq
MIRT2079568	hsa-miR-3140-5p	CLIP-seq
MIRT2305905	hsa-miR-3189-5p	CLIP-seq
MIRT2079570	hsa-miR-365	CLIP-seq
MIRT2305906	hsa-miR-3691-3p	CLIP-seq
MIRT1552661	hsa-miR-4758-3p	CLIP-seq
MIRT2079579	hsa-miR-515-5p	CLIP-seq
MIRT2603137	hsa-miR-1	CLIP-seq
MIRT2603138	hsa-miR-1254	CLIP-seq
MIRT2603139	hsa-miR-1910	CLIP-seq
MIRT2603140	hsa-miR-206	CLIP-seq
MIRT2603141	hsa-miR-223	CLIP-seq
MIRT2603142	hsa-miR-2861	CLIP-seq
MIRT2603143	hsa-miR-3116	CLIP-seq
MIRT2603144	hsa-miR-3130-5p	CLIP-seq
MIRT2079568	hsa-miR-3140-5p	CLIP-seq
MIRT2603145	hsa-miR-3150a-3p	CLIP-seq
MIRT2603146	hsa-miR-3175	CLIP-seq
MIRT2305905	hsa-miR-3189-5p	CLIP-seq
MIRT2079569	hsa-miR-3612	CLIP-seq
MIRT2079570	hsa-miR-365	CLIP-seq
MIRT2305906	hsa-miR-3691-3p	CLIP-seq
MIRT2603147	hsa-miR-3942-3p	CLIP-seq
MIRT2079571	hsa-miR-3975	CLIP-seq
MIRT2079573	hsa-miR-4443	CLIP-seq
MIRT2603148	hsa-miR-4482	CLIP-seq
MIRT2603149	hsa-miR-4511	CLIP-seq
MIRT2603150	hsa-miR-4512	CLIP-seq
MIRT2603151	hsa-miR-455-3p	CLIP-seq
MIRT2603152	hsa-miR-4649-5p	CLIP-seq
MIRT2603153	hsa-miR-4667-5p	CLIP-seq
MIRT2603154	hsa-miR-4697-3p	CLIP-seq
MIRT2603155	hsa-miR-4700-5p	CLIP-seq
MIRT1552661	hsa-miR-4758-3p	CLIP-seq
MIRT2079579	hsa-miR-515-5p	CLIP-seq
MIRT2603156	hsa-miR-548b-3p	CLIP-seq
MIRT2603157	hsa-miR-593	CLIP-seq
MIRT2603158	hsa-miR-613	CLIP-seq
MIRT2079580	hsa-miR-650	CLIP-seq
MIRT2603159	hsa-miR-7	CLIP-seq
MIRT2603160	hsa-miR-939	CLIP-seq
MIRT2603137	hsa-miR-1	CLIP-seq
MIRT2603138	hsa-miR-1254	CLIP-seq
MIRT2603139	hsa-miR-1910	CLIP-seq
MIRT2603140	hsa-miR-206	CLIP-seq
MIRT2603141	hsa-miR-223	CLIP-seq
MIRT2603142	hsa-miR-2861	CLIP-seq
MIRT2603143	hsa-miR-3116	CLIP-seq
MIRT2603144	hsa-miR-3130-5p	CLIP-seq
MIRT2079568	hsa-miR-3140-5p	CLIP-seq
MIRT2603145	hsa-miR-3150a-3p	CLIP-seq
MIRT2603146	hsa-miR-3175	CLIP-seq
MIRT2305905	hsa-miR-3189-5p	CLIP-seq
MIRT2079569	hsa-miR-3612	CLIP-seq
MIRT2079570	hsa-miR-365	CLIP-seq
MIRT2305906	hsa-miR-3691-3p	CLIP-seq
MIRT2603147	hsa-miR-3942-3p	CLIP-seq
MIRT2079571	hsa-miR-3975	CLIP-seq
MIRT2079573	hsa-miR-4443	CLIP-seq
MIRT2603148	hsa-miR-4482	CLIP-seq
MIRT2603149	hsa-miR-4511	CLIP-seq
MIRT2603150	hsa-miR-4512	CLIP-seq
MIRT2603151	hsa-miR-455-3p	CLIP-seq
MIRT2603153	hsa-miR-4667-5p	CLIP-seq
MIRT2603154	hsa-miR-4697-3p	CLIP-seq
MIRT2603155	hsa-miR-4700-5p	CLIP-seq
MIRT1552661	hsa-miR-4758-3p	CLIP-seq
MIRT2079579	hsa-miR-515-5p	CLIP-seq
MIRT2603156	hsa-miR-548b-3p	CLIP-seq
MIRT2603157	hsa-miR-593	CLIP-seq
MIRT2603158	hsa-miR-613	CLIP-seq
MIRT2079580	hsa-miR-650	CLIP-seq
MIRT2603159	hsa-miR-7	CLIP-seq
MIRT2603160	hsa-miR-939	CLIP-seq

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	29290612, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	TAS	7621825
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA	21873635
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	ISS
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

MIM	HGNC	e!Ensembl
617844	9566	ENSG00000099341

Protein

UniProt ID

P48556

Protein name

26S proteasome non-ATPase regulatory subunit 8 (26S proteasome regulatory subunit RPN12) (26S proteasome regulatory subunit S14) (p31)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M , 8CVT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10075	CSN8_PSD8_EIF3K	186 → 327	CSN8/PSMD8/EIF3K family	Family

Sequence

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAA
SRKMAAAAVNGAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLK
LVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKE
QLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGS
YNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMT
DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Sequence length

350

Interactions

View interactions

PSMD8 (proteasome 26S subunit, non-ATPase 8)