Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9861
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, non-ATPase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMD6
Synonyms (NCBI Gene) Gene synonyms aliases	Rpn7, S10, SGA-113M, p42A, p44S10
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing res

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024707	hsa-miR-215-5p	Microarray	19074876
MIRT026186	hsa-miR-192-5p	Microarray	19074876
MIRT046979	hsa-miR-219a-5p	CLASH	23622248
MIRT043296	hsa-miR-331-3p	CLASH	23622248
MIRT038175	hsa-miR-423-5p	CLASH	23622248
MIRT1270616	hsa-miR-1285	CLIP-seq
MIRT1270617	hsa-miR-3121-5p	CLIP-seq
MIRT1270618	hsa-miR-3163	CLIP-seq
MIRT1270619	hsa-miR-3187-5p	CLIP-seq
MIRT1270620	hsa-miR-3611	CLIP-seq
MIRT1270621	hsa-miR-3661	CLIP-seq
MIRT1270622	hsa-miR-3675-3p	CLIP-seq
MIRT1270623	hsa-miR-4289	CLIP-seq
MIRT1270624	hsa-miR-4422	CLIP-seq
MIRT1270625	hsa-miR-4509	CLIP-seq
MIRT1270626	hsa-miR-4666-5p	CLIP-seq
MIRT1270627	hsa-miR-4744	CLIP-seq
MIRT1270628	hsa-miR-4789-5p	CLIP-seq
MIRT1270629	hsa-miR-4802-3p	CLIP-seq
MIRT1270630	hsa-miR-500a	CLIP-seq
MIRT1270631	hsa-miR-501-5p	CLIP-seq
MIRT1270632	hsa-miR-548c-3p	CLIP-seq
MIRT1270633	hsa-miR-612	CLIP-seq
MIRT1270634	hsa-miR-631	CLIP-seq
MIRT1270635	hsa-miR-944	CLIP-seq
MIRT1270616	hsa-miR-1285	CLIP-seq
MIRT1270618	hsa-miR-3163	CLIP-seq
MIRT1270619	hsa-miR-3187-5p	CLIP-seq
MIRT1270620	hsa-miR-3611	CLIP-seq
MIRT1270621	hsa-miR-3661	CLIP-seq
MIRT1270622	hsa-miR-3675-3p	CLIP-seq
MIRT1270623	hsa-miR-4289	CLIP-seq
MIRT1270628	hsa-miR-4789-5p	CLIP-seq
MIRT1270632	hsa-miR-548c-3p	CLIP-seq
MIRT1270633	hsa-miR-612	CLIP-seq
MIRT1270634	hsa-miR-631	CLIP-seq
MIRT1270635	hsa-miR-944	CLIP-seq
MIRT1270621	hsa-miR-3661	CLIP-seq
MIRT1270628	hsa-miR-4789-5p	CLIP-seq
MIRT1270634	hsa-miR-631	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
BRCA2	Unknown	17563742

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0005515	Function	Protein binding	IPI	16990800, 25416956, 32296183, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IBA
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
617857	9564	ENSG00000163636

Protein

UniProt ID

Q15008

Protein name

26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit RPN7) (26S proteasome regulatory subunit S10) (Breast cancer-associated protein SGA-113M) (Phosphonoformate immuno-associated protein 4) (Proteasome regulatory particle subu

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M , 8CVT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10602	RPN7	66 → 239	26S proteasome subunit RPN7	Family
PF01399	PCI	254 → 358	PCI domain	Domain

Sequence

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKS
LDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGA
LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
SKNWQYQETIKKGDLLLNRVQKLSRVINM

Sequence length

389

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Pancreatic Ductal	Associate	33525943
Depressive Disorder Major	Associate	31305436
Diabetes Mellitus Type 2	Associate	25273842, 26024304
Parkinson Disease	Associate	29852216

PSMD6 (proteasome 26S subunit, non-ATPase 6)