Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5708
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit ubiquitin receptor, non-ATPase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMD2
Synonyms (NCBI Gene) Gene synonyms aliases	P97, RPN1, S2, TRAP2
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q27.1
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004400	hsa-miR-200a-3p	Microarray, Northern blot	16331254
MIRT051506	hsa-let-7e-5p	CLASH	23622248
MIRT050480	hsa-miR-20a-5p	CLASH	23622248
MIRT049452	hsa-miR-92a-3p	CLASH	23622248
MIRT045290	hsa-miR-186-5p	CLASH	23622248
MIRT044106	hsa-miR-361-5p	CLASH	23622248
MIRT043381	hsa-miR-331-3p	CLASH	23622248
MIRT043028	hsa-miR-324-5p	CLASH	23622248
MIRT042898	hsa-miR-324-3p	CLASH	23622248
MIRT039985	hsa-miR-615-3p	CLASH	23622248
MIRT039985	hsa-miR-615-3p	CLASH	23622248
MIRT1270502	hsa-miR-1264	CLIP-seq
MIRT1270503	hsa-miR-1273	CLIP-seq
MIRT1270504	hsa-miR-1273c	CLIP-seq
MIRT1270505	hsa-miR-1276	CLIP-seq
MIRT1270506	hsa-miR-2278	CLIP-seq
MIRT1270507	hsa-miR-4459	CLIP-seq
MIRT1270508	hsa-miR-4695-5p	CLIP-seq
MIRT1270509	hsa-miR-4722-5p	CLIP-seq
MIRT1270510	hsa-miR-4797-3p	CLIP-seq
MIRT1270511	hsa-miR-495	CLIP-seq
MIRT1270512	hsa-miR-548n	CLIP-seq
MIRT1270513	hsa-miR-548t	CLIP-seq
MIRT1270514	hsa-miR-802	CLIP-seq
MIRT2079493	hsa-miR-1207-3p	CLIP-seq
MIRT1270503	hsa-miR-1273	CLIP-seq
MIRT1270504	hsa-miR-1273c	CLIP-seq
MIRT2079494	hsa-miR-370	CLIP-seq
MIRT1270507	hsa-miR-4459	CLIP-seq
MIRT1270508	hsa-miR-4695-5p	CLIP-seq
MIRT1270509	hsa-miR-4722-5p	CLIP-seq
MIRT2305783	hsa-miR-1184	CLIP-seq
MIRT2305784	hsa-miR-1205	CLIP-seq
MIRT1270503	hsa-miR-1273	CLIP-seq
MIRT1270504	hsa-miR-1273c	CLIP-seq
MIRT1270505	hsa-miR-1276	CLIP-seq
MIRT1270506	hsa-miR-2278	CLIP-seq
MIRT2305785	hsa-miR-3158-5p	CLIP-seq
MIRT2305786	hsa-miR-361-3p	CLIP-seq
MIRT2305787	hsa-miR-3679-3p	CLIP-seq
MIRT1270507	hsa-miR-4459	CLIP-seq
MIRT1270508	hsa-miR-4695-5p	CLIP-seq
MIRT1270509	hsa-miR-4722-5p	CLIP-seq
MIRT1270510	hsa-miR-4797-3p	CLIP-seq
MIRT1270511	hsa-miR-495	CLIP-seq
MIRT1270514	hsa-miR-802	CLIP-seq
MIRT1270510	hsa-miR-4797-3p	CLIP-seq
MIRT1270514	hsa-miR-802	CLIP-seq
MIRT1270510	hsa-miR-4797-3p	CLIP-seq
MIRT1270514	hsa-miR-802	CLIP-seq

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	11278995, 16189514, 16763564, 16990800, 18457437, 18922472, 19060904, 19490896, 19615732, 22901813, 25036637, 25416956, 26496610, 28514442, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	TAS	8774743
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034515	Component	Proteasome storage granule	IBA	21873635
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
606223	9559	ENSG00000175166

Protein

UniProt ID

Q13200

Protein name

26S proteasome non-ATPase regulatory subunit 2 (26S proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Protein 55.11) (Tumor necrosis factor type 1 receptor-associated protein 2)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7UIH , 7UJD , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17781	RPN1_RPN2_N	56 → 354	RPN1/RPN2 N-terminal domain	Domain
PF01851	PC_rep	443 → 479	Proteasome/cyclosome repeat	Repeat
PF01851	PC_rep	480 → 514	Proteasome/cyclosome repeat	Repeat
PF18051	RPN1_C	853 → 906	26S proteasome non-ATPase regulatory subunit RPN1 C-terminal	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in skeletal muscle, liver, heart, brain, kidney, pancreas, lung and placenta.

Sequence

MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKR
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYDL

Sequence length

908

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Atrial Fibrillation	Atrial Fibrillation			GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	23874428
Breast Neoplasms	Associate	29328377
Breast Neoplasms	Stimulate	34839279
Carcinoma Hepatocellular	Associate	31703613, 36292719
Carcinoma Non Small Cell Lung	Associate	37864031
Colorectal Neoplasms	Associate	35173535
Depressive Disorder Major	Associate	31305436
Diabetes Mellitus Type 2	Associate	28253288
Heat Stress Disorders	Associate	25280538
Leukemia Myeloid Acute	Associate	25734857
Liver Failure	Associate	25280538
Nasopharyngeal Carcinoma	Associate	37875476
Neoplasm Metastasis	Associate	23874428
Neoplasms	Associate	31703613, 34398824, 36123629
Ovarian Neoplasms	Associate	37349676
Squamous Cell Carcinoma of Head and Neck	Associate	34398824
Stomach Neoplasms	Associate	31136974
Thyroiditis	Associate	28390009

PSMD2 (proteasome 26S subunit ubiquitin receptor, non-ATPase 2)