Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10213
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, non-ATPase 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMD14
Synonyms (NCBI Gene) Gene synonyms aliases	PAD1, POH1, RPN11
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S

Show/Hide all(89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046307	hsa-miR-23b-3p	CLASH	23622248
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270461	hsa-miR-186	CLIP-seq
MIRT1270462	hsa-miR-2276	CLIP-seq
MIRT1270463	hsa-miR-2355-3p	CLIP-seq
MIRT1270464	hsa-miR-25	CLIP-seq
MIRT1270465	hsa-miR-302f	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT1270467	hsa-miR-3133	CLIP-seq
MIRT1270468	hsa-miR-3171	CLIP-seq
MIRT1270469	hsa-miR-32	CLIP-seq
MIRT1270470	hsa-miR-363	CLIP-seq
MIRT1270471	hsa-miR-3667-5p	CLIP-seq
MIRT1270472	hsa-miR-367	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270476	hsa-miR-4282	CLIP-seq
MIRT1270477	hsa-miR-4436b-5p	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT1270479	hsa-miR-4646-3p	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270482	hsa-miR-4725-5p	CLIP-seq
MIRT1270483	hsa-miR-4732-3p	CLIP-seq
MIRT1270484	hsa-miR-4744	CLIP-seq
MIRT1270485	hsa-miR-4772-3p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270489	hsa-miR-495	CLIP-seq
MIRT1270490	hsa-miR-504	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270492	hsa-miR-518a-5p	CLIP-seq
MIRT1270493	hsa-miR-527	CLIP-seq
MIRT1270494	hsa-miR-568	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT1270498	hsa-miR-630	CLIP-seq
MIRT1270499	hsa-miR-664	CLIP-seq
MIRT1270500	hsa-miR-92a	CLIP-seq
MIRT1270501	hsa-miR-92b	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT2603089	hsa-miR-3672	CLIP-seq
MIRT2603090	hsa-miR-3910	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT2603091	hsa-miR-4493	CLIP-seq
MIRT2603092	hsa-miR-4499	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT2603093	hsa-miR-633	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT2603089	hsa-miR-3672	CLIP-seq
MIRT2603090	hsa-miR-3910	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT2603091	hsa-miR-4493	CLIP-seq
MIRT2603092	hsa-miR-4499	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT2603093	hsa-miR-633	CLIP-seq

Show/Hide all(60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	TAS	19214193
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	22909820
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	IBA	21873635
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	IMP	22909820
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	TAS	19214193
GO:0005515	Function	Protein binding	IPI	19615732, 25416956, 25959826, 26496610, 28514442, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IMP	22909820
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	9374539
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008237	Function	Metallopeptidase activity	IBA	21873635
GO:0008237	Function	Metallopeptidase activity	TAS	19214193
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA	21873635
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IMP	22909820
GO:0010950	Process	Positive regulation of endopeptidase activity	IEA
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	IBA	21873635
GO:0016579	Process	Protein deubiquitination	TAS
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031597	Component	Cytosolic proteasome complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061133	Function	Endopeptidase activator activity	IMP	18162577
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IMP	18162577
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0061578	Function	Lys63-specific deubiquitinase activity	TAS
GO:0070122	Function	Isopeptidase activity	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070536	Process	Protein K63-linked deubiquitination	IMP	22909820
GO:0070536	Process	Protein K63-linked deubiquitination	TAS	19214193
GO:0070628	Function	Proteasome binding	IBA	21873635
GO:0070628	Function	Proteasome binding	IDA	18162577
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
607173	16889	ENSG00000115233

Protein

UniProt ID

O00487

Protein name

26S proteasome non-ATPase regulatory subunit 14 (EC 3.4.19.-) (26S proteasome regulatory subunit RPN11) (26S proteasome-associated PAD1 homolog 1)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01398	JAB	26 → 139	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
PF13012	MitMem_reg	173 → 307	Maintenance of mitochondrial structure and function	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highest levels in heart and skeletal muscle. {ECO:0000269|PubMed:9374539}.

Sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK

Sequence length

310

Interactions

View interactions

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	Source
Unknown
Neuroticism	Neuroticism		GWAS
Mental Depression	Mental Depression		GWAS
Crohn Disease	Crohn Disease		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Insomnia	Insomnia		GWAS

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Inhibit	27050411
Alzheimer Disease	Associate	29848990
Breast Neoplasms	Stimulate	34839279
Breast Neoplasms	Associate	38017133
Carcinogenesis	Associate	28653889, 31685442
Carcinoma Hepatocellular	Associate	34745496
Colorectal Neoplasms	Associate	31685442
Disease	Associate	24625750
DNA Repair Deficiency Disorders	Associate	34975746
Inflammation	Associate	24005050, 34383385
Melanoma	Associate	33154524
Multiple Myeloma	Associate	37935198
Neoplasm Metastasis	Stimulate	34383385
Neoplasms	Associate	31685442, 35750900, 37975230
Neoplasms	Stimulate	34383385, 36328147, 36632137
Osteosarcoma	Associate	34383385
Ovarian Neoplasms	Stimulate	34382324, 36328147
Ovarian Neoplasms	Associate	37349676
Pre Eclampsia	Associate	36421809
Squamous Cell Carcinoma of Head and Neck	Associate	35750900
Urinary Bladder Neoplasms	Stimulate	36632137
Urinary Bladder Neoplasms	Associate	37975230
Varicocele	Associate	34975746

PSMD14 (proteasome 26S subunit, non-ATPase 14)