Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5719
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, non-ATPase 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMD13
Synonyms (NCBI Gene) Gene synonyms aliases	HSPC027, Rpn9, S11, p40.5
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047716	hsa-miR-10a-5p	CLASH	23622248
MIRT047503	hsa-miR-10b-5p	CLASH	23622248
MIRT047134	hsa-miR-183-5p	CLASH	23622248
MIRT045260	hsa-miR-186-5p	CLASH	23622248
MIRT040064	hsa-miR-615-3p	CLASH	23622248
MIRT038884	hsa-miR-93-3p	CLASH	23622248
MIRT1270458	hsa-miR-604	CLIP-seq
MIRT1270459	hsa-miR-647	CLIP-seq
MIRT2603050	hsa-miR-1184	CLIP-seq
MIRT2603051	hsa-miR-1205	CLIP-seq
MIRT2603052	hsa-miR-125a-5p	CLIP-seq
MIRT2603053	hsa-miR-125b	CLIP-seq
MIRT2603054	hsa-miR-1286	CLIP-seq
MIRT2603055	hsa-miR-1303	CLIP-seq
MIRT2603056	hsa-miR-132	CLIP-seq
MIRT2603057	hsa-miR-1324	CLIP-seq
MIRT2603058	hsa-miR-149	CLIP-seq
MIRT2603059	hsa-miR-185	CLIP-seq
MIRT2603060	hsa-miR-1910	CLIP-seq
MIRT2603061	hsa-miR-212	CLIP-seq
MIRT2603062	hsa-miR-2278	CLIP-seq
MIRT2603063	hsa-miR-3158-5p	CLIP-seq
MIRT2603064	hsa-miR-339-5p	CLIP-seq
MIRT2603065	hsa-miR-3667-5p	CLIP-seq
MIRT2603066	hsa-miR-4270	CLIP-seq
MIRT2603067	hsa-miR-4303	CLIP-seq
MIRT2603068	hsa-miR-4306	CLIP-seq
MIRT2603069	hsa-miR-4319	CLIP-seq
MIRT2603070	hsa-miR-4324	CLIP-seq
MIRT2603071	hsa-miR-4329	CLIP-seq
MIRT2603072	hsa-miR-4441	CLIP-seq
MIRT2603073	hsa-miR-4468	CLIP-seq
MIRT2603074	hsa-miR-451b	CLIP-seq
MIRT2603075	hsa-miR-4644	CLIP-seq
MIRT2603076	hsa-miR-4661-3p	CLIP-seq
MIRT2603077	hsa-miR-4722-5p	CLIP-seq
MIRT2603078	hsa-miR-4725-5p	CLIP-seq
MIRT2603079	hsa-miR-4733-5p	CLIP-seq
MIRT2603080	hsa-miR-4768-3p	CLIP-seq
MIRT2603081	hsa-miR-4768-5p	CLIP-seq
MIRT2603082	hsa-miR-4773	CLIP-seq
MIRT2603083	hsa-miR-4786-5p	CLIP-seq
MIRT2603084	hsa-miR-504	CLIP-seq
MIRT2603085	hsa-miR-564	CLIP-seq
MIRT2603086	hsa-miR-622	CLIP-seq
MIRT2603087	hsa-miR-663b	CLIP-seq
MIRT2603088	hsa-miR-769-5p	CLIP-seq
MIRT2603050	hsa-miR-1184	CLIP-seq
MIRT2603051	hsa-miR-1205	CLIP-seq
MIRT2603052	hsa-miR-125a-5p	CLIP-seq
MIRT2603053	hsa-miR-125b	CLIP-seq
MIRT2603054	hsa-miR-1286	CLIP-seq
MIRT2603055	hsa-miR-1303	CLIP-seq
MIRT2603056	hsa-miR-132	CLIP-seq
MIRT2603057	hsa-miR-1324	CLIP-seq
MIRT2603058	hsa-miR-149	CLIP-seq
MIRT2603059	hsa-miR-185	CLIP-seq
MIRT2603060	hsa-miR-1910	CLIP-seq
MIRT2603061	hsa-miR-212	CLIP-seq
MIRT2603062	hsa-miR-2278	CLIP-seq
MIRT2603063	hsa-miR-3158-5p	CLIP-seq
MIRT2603064	hsa-miR-339-5p	CLIP-seq
MIRT2603065	hsa-miR-3667-5p	CLIP-seq
MIRT2603066	hsa-miR-4270	CLIP-seq
MIRT2603068	hsa-miR-4306	CLIP-seq
MIRT2603069	hsa-miR-4319	CLIP-seq
MIRT2603070	hsa-miR-4324	CLIP-seq
MIRT2603071	hsa-miR-4329	CLIP-seq
MIRT2603072	hsa-miR-4441	CLIP-seq
MIRT2603074	hsa-miR-451b	CLIP-seq
MIRT2603075	hsa-miR-4644	CLIP-seq
MIRT2603076	hsa-miR-4661-3p	CLIP-seq
MIRT2603077	hsa-miR-4722-5p	CLIP-seq
MIRT2603078	hsa-miR-4725-5p	CLIP-seq
MIRT2603079	hsa-miR-4733-5p	CLIP-seq
MIRT2603080	hsa-miR-4768-3p	CLIP-seq
MIRT2603081	hsa-miR-4768-5p	CLIP-seq
MIRT2603082	hsa-miR-4773	CLIP-seq
MIRT2603083	hsa-miR-4786-5p	CLIP-seq
MIRT2603084	hsa-miR-504	CLIP-seq
MIRT2603085	hsa-miR-564	CLIP-seq
MIRT2603086	hsa-miR-622	CLIP-seq
MIRT2603087	hsa-miR-663b	CLIP-seq
MIRT2603088	hsa-miR-769-5p	CLIP-seq

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005198	Function	Structural molecule activity	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	TAS	9714768
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0007127	Process	Meiosis I	IEA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043248	Process	Proteasome assembly	IBA	21873635
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
603481	9558	ENSG00000185627

Protein

UniProt ID

Q9UNM6

Protein name

26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit RPN9) (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01399	PCI	231 → 335	PCI domain	Domain

Sequence

MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLY
ENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGA
LKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFL
GCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAF
NSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSA
KITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWCTDV
KSMEMLVEHQAHDILT

Sequence length

376

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Endometriosis	Endometriosis	GWAS
Uterine Fibroids	Uterine Fibroids	GWAS
Cerebral Aneurysm	Cerebral Aneurysm	GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	27534557
Cholangiocarcinoma	Associate	39239747
Depressive Disorder Major	Associate	26624926
Depressive Disorder Treatment Resistant	Associate	26624926
Endometrial Neoplasms	Associate	36731897
Leber Congenital Amaurosis	Associate	25752820
Leukemia Myeloid Acute	Inhibit	37653079
Precancerous Conditions	Associate	36731897
Skin Diseases	Associate	40443672
Vitiligo	Associate	40443672

PSMD13 (proteasome 26S subunit, non-ATPase 13)